4AE4: Ubiquitin-associated protein 1

The UBAP1 subunit of ESCRT-I interacts with ubiquitin via a novel SOUBA domain. Determined by X-ray diffraction at 1.65 Å resolution. Released 21 Mar 2012.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 2,101
Mol. weight: 28.32 kDa
Ligands: NHE
Released: 21 Mar 2012

Explore 4AE4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4AE4 contains 14 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	390-401	12
α-helix	406-416	11
α-helix	420-435	16
α-helix	440-449	10
α-helix	454-469	16
α-helix	474-483	10
α-helix	488-498	11

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	390-401	12
α-helix	406-416	11
α-helix	420-435	16
α-helix	440-449	10
α-helix	454-470	17
α-helix	474-483	10
α-helix	488-496	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-associated protein 1	A	protein	118	HOMO SAPIENS	Q9NZ09 (AlphaFold model)
Ubiquitin-associated protein 1	B	protein	118	HOMO SAPIENS	Q9NZ09 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4AE4_1 UBIQUITIN-ASSOCIATED PROTEIN 1 (chains A)
GSHMSPSERQCVETVVNMGYSYECVLRAMKAAGANIEQILDYLFAHGQLCEKGFDPLLVE
EALEMHQCSEEKMMEFLQLMSKFKEMGFELKDIKEVLLLHNNDQDNALEDLMARAGAS

Sequence of entity 2 (B), FASTA

>4AE4_2 UBIQUITIN-ASSOCIATED PROTEIN 1 (chains B)
GSHMSPSERQCVETVVNMGYSYECVLRAMKAAGANIEQILDYLFAHGQLCEKGFDPLLVE
EALEMHQCSEEKMMEFLQLMSKFKEMGFELKDIKEVLLLHNNDQDNALEDLMARAGAS

Ligands and cofactors

ID	Name	Formula	Copies
NHE	2-[N-cyclohexylamino]ethane sulfonic acid	C8 H17 N O3 S	2

Water and common crystallization additives (K, GOL, NA) are not listed.

Primary citation

The UBAP1 subunit of ESCRT-I interacts with ubiquitin via a SOUBA domain. Agromayor, M., Soler, N., Caballe, A. et al. Structure (2012) 20:414-428. DOI 10.1016/j.str.2011.12.013 · PubMed

Other PDB entries of the same protein (UniProt Q9NZ09 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5LM1 2.55 Å, Crystal Structure of HD-PTP phosphatase in complex with UBAP1
1WGN Solution Structure of UBA domain of Human Ubiquitin Associated Protein 1 (UBAP1)

Browse structure collections

About this viewer

MolViewer shows 4AE4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.