5LM1: HD-PTP phosphatase

Crystal Structure of HD-PTP phosphatase in complex with UBAP1. Determined by X-ray diffraction at 2.55 Å resolution. Released 30 Nov 2016.

Method: X-ray diffraction
Resolution: 2.55 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,742
Mol. weight: 42.39 kDa
Released: 30 Nov 2016

Explore 5LM1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5LM1 contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	6-41	36
α-helix	50-55	6
α-helix	57-58	2
α-helix	59-67	9
α-helix	74-116	43
α-helix	125-170	46
α-helix	173-179	7
α-helix	187-227	41
α-helix	238-349	112

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	263-265	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase non-receptor type 23	A	protein	352	Homo sapiens	Q9H3S7 (AlphaFold model)
Ubap-1	B	protein	20	Homo sapiens	Q9NZ09 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5LM1_1 Tyrosine-protein phosphatase non-receptor type 23 (chains A)
PMAAHEASSLYSEEKAKLLREMMAKIEDKNEVLDQFMDSMQLDPETVDNLDAYSHIPPQL
MEKCAALSVRPDTVRNLVQSMQVLSGVFTDVEASLKDIRDLLEEDELLEQKFQEAVGQAG
AISITSKAELAEVRREWAKYMEVHEKASFTNSELHRAMNLHVGNLRLLSGPLDQVRAALP
TPALSPEDKAVLQNLKRILAKVQEMRDQRVSLEQQLRELIQKDDITASLVTTDHSEMKKL
FEEQLKKYDQLKVYLEQNLAAQDRVLCALTEANVQYAAVRRVLSDLDQKWNSTLQTLVAS
YEAYEDLMKKSQEGRDFYADLESKVAALLERTQSTCQAREAARQQLLDRELK

Sequence of entity 2 (B), FASTA

>5LM1_2 UBAP-1 (chains B)
SNIKSLSFPKLDSDDSNQKT

Primary citation

Structural Basis for Selective Interaction between the ESCRT Regulator HD-PTP and UBAP1. Gahloth, D., Levy, C., Heaven, G. et al. Structure (2016) 24:2115-2126. DOI 10.1016/j.str.2016.10.006 · PubMed

Other PDB entries of the same protein (UniProt Q9H3S7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MK2 1.7 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro1…
5MK0 1.76 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro1…
5MJZ 1.87 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro1…
3RAU 1.95 Å, Crystal structure of the HD-PTP Bro1 domain
5MK3 2.0 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro 1…
5CRV 2.0 Å, Crystal structure of the Bro domain of HD-PTP in a complex with the core region of STAM2
5MJY 2.25 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro1…
5CRU 2.4 Å, Crystal structure of the Bro domain of HD-PTP
5MK1 2.5 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro1…
5LM2 2.54 Å, Crystal Structure of HD-PTP phosphatase

Browse structure collections

About this viewer

MolViewer shows 5LM1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.