1WHL: Cylindromatosis tumor suppressor CYLD

Solution structure of the 1st CAP-Gly domain in human cylindromatosis tumor suppressor CYLD. Determined by solution NMR. Released 28 Nov 2004.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 705
Mol. weight: 10.04 kDa
Released: 28 Nov 2004

Explore 1WHL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WHL contains 1 α-helix and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	13-17	5	1
β-strand	24-32	9	1
β-strand	46-50	5	1
β-strand	63-64	2	2
β-strand	67-68	2	2
β-strand	77-80	4	1
α-helix	82-84	3
β-strand	85-87	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cylindromatosis tumor suppressor CYLD	A	protein	95	Homo sapiens	Q9NQC7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WHL_1 Cylindromatosis tumor suppressor CYLD (chains A)
GSSGSSGIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFT
DGVYQGKQLFQCDEDCGVFVALDKLELIESGPSSG

Primary citation

Solution structure of the 1st CAP-Gly domain in human cylindromatosis tumor suppressor CYLD. Saito, K., Koshiba, S., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q9NQC7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7OWD 1.71 Å, Structure of CYLD CAP-Gly3 (467-552) bound to Ub; tetragonal space group
9TMK 1.8 Å, Structure of CYLD CAP-Gly2 bound to Listeria effector protein InlC
7OWC 1.85 Å, Structure of CYLD CAP-Gly3 (467-565) bound to Ub; orthorhobic space group
2VHF 2.8 Å, Structure of the CYLD USP domain
1IXD Solution structure of the CAP-GLY domain from human cylindromatosis tomour-suppressor CYLD
1WHM Solution structure of the 2nd CAP-Gly domain in human cylindromatosis tumor suppressor…

Browse structure collections

About this viewer

MolViewer shows 1WHL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.