Solution structure of the 2nd CAP-Gly domain in human cylindromatosis tumor suppressor CYLD. Determined by solution NMR. Released 28 Nov 2004.
Explore 1WHM in 3D Show helices and sheets RCSB PDB PDBe
1WHM contains 2 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11 | 1 | |
| β-strand | 15-20 | 6 | 1 |
| β-strand | 23-33 | 11 | 1 |
| β-strand | 44-49 | 6 | 1 |
| β-strand | 59-60 | 2 | 2 |
| β-strand | 63-64 | 2 | 2 |
| β-strand | 74-78 | 5 | 1 |
| α-helix | 79-81 | 3 | |
| β-strand | 82-84 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cylindromatosis tumor suppressor CYLD | A | protein | 92 | Homo sapiens | Q9NQC7 (AlphaFold model) |
>1WHM_1 Cylindromatosis tumor suppressor CYLD (chains A) GSSGSSGPPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRF DGVQLCSFACVESTILLHINDIIPESSGPSSG
Solution structure of the 2nd CAP-Gly domain in human cylindromatosis tumor suppressor CYLD. Saitok, K., Koshiba, S., Inoue, M. et al. To be published.
Other PDB entries of the same protein (UniProt Q9NQC7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1WHM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.