1WKW: Ternary complex of eIF4E-m7GpppA-4EBP1 peptide

Crystal structure of the ternary complex of eIF4E-m7GpppA-4EBP1 peptide. Determined by X-ray diffraction at 2.1 Å resolution. Released 10 Jun 2005.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,875
Mol. weight: 25.43 kDa
Ligands: GTA
Released: 10 Jun 2005

Explore 1WKW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WKW contains 12 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	31-34	4
β-strand	38-48	11	1
α-helix	56-59	4
β-strand	60-68	9	1
α-helix	69-77	9
α-helix	82-84	3
α-helix	86	1
β-strand	87	1	2
β-strand	89	1	2
β-strand	90-95	6	1
β-strand	111-116	6	1
α-helix	117-118	2
α-helix	121-124	4
α-helix	126-138	13
α-helix	143-147	5
β-strand	149-155	7	1
β-strand	162-167	6	1
α-helix	173-187	15
β-strand	197-199	3	1
α-helix	200-202	3
β-strand	215	1	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	56-61	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic translation initiation factor 4E	A	protein	191	Homo sapiens	P06730 (AlphaFold model)
Eukaryotic translation initiation factor 4E binding protein 1	B	protein	20	Homo sapiens	Q13541 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WKW_1 Eukaryotic translation initiation factor 4E (chains A)
EVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLM
PGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYS
DDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATK
SGSTTKNRFVV

Sequence of entity 2 (B), FASTA

>1WKW_2 Eukaryotic translation initiation factor 4E binding protein 1 (chains B)
PGGTRIIYDRKFLMECRNSP

Ligands and cofactors

ID	Name	Formula	Copies
GTA	P1-7-methylguanosine-P3-adenosine-5',5'-triphosphate	C21 H30 N10 O17 P3	1

Primary citation

Structural basis for mRNA Cap-Binding regulation of eukaryotic initiation factor 4E by 4E-binding protein, studied by spectroscopic, X-ray crystal structural, and molecular dynamics simulation methods. Tomoo, K., Matsushita, Y., Fujisaki, H. et al. Biochim Biophys Acta (2005) 1753:191-208. DOI 10.1016/j.bbapap.2005.07.023 · PubMed

Other PDB entries of the same protein (UniProt P06730 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4TPW 1.5 Å, The co-complex structure of the translation initiation factor eIF4E with the inhibitor…
5T46 1.53 Å, Crystal structure of the human eIF4E-eIF4G complex
8QM8 1.58 Å, Potential drug binding sites for translation initiation factor eIF4E
4TQB 1.59 Å, The co-complex structure of the translation initiation factor eIF4E with the inhibitor…
5ZJY 1.59 Å, Stapled-peptides tailored against initiation of translation
7D6Y 1.67 Å, eIF4E in Complex with a Disulphide-Free Autonomous VH Domain
5ZJZ 1.67 Å, Stapled-peptides tailored against initiation of translation
5EI3 1.71 Å, Co-crystal structure of eIF4E with nucleotide mimetic inhibitor.
4UED 1.75 Å, Complex of human eIF4E with the 4E binding protein 4E-BP1
5ZK9 1.76 Å, Stapled-peptides tailored against initiation of translation
4TQC 1.8 Å, The co-complex structure of the translation initiation factor eIF4E with the inhibitor…
5ZML 1.8 Å, Stapled-peptides tailored against initiation of translation

Browse structure collections

About this viewer

MolViewer shows 1WKW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.