1WRK: N-terminal domain of human cardiac troponin C

Crystal structure of the N-terminal domain of human cardiac troponin C in complex with trifluoperazine (orthrombic crystal form). Determined by X-ray diffraction at 2.15 Å resolution. Released 24 Jan 2006.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,490
Mol. weight: 21.61 kDa
Ligands: TFP, CA
Released: 24 Jan 2006

Explore 1WRK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WRK contains 10 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	5-11	7
α-helix	14-27	14
β-strand	36	1	1
α-helix	38-47	10
α-helix	54-62	9
β-strand	72	1	1
α-helix	74-83	10

Chain B: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	5-10	6
α-helix	14-27	14
β-strand	36	1	2
α-helix	38-47	10
α-helix	54-64	11
β-strand	72	1	2
α-helix	74-83	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Troponin C, slow skeletal and cardiac muscles	A, B	protein	88	Homo sapiens	P63316 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1WRK_1 Troponin C, slow skeletal and cardiac muscles (chains A, B)
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRSMKDD

Ligands and cofactors

ID	Name	Formula	Copies
TFP	10-[3-(4-methyl-piperazin-1-yl)-propyl]-2-trifluoromethyl-10H-phenothiazine	C21 H24 F3 N3 S	4
CA	Calcium ion	Ca	2

Primary citation

Crystal structure of the N-terminal domain of human cardiac troponin C in complex with trifluoperazine. Takeda, S., Igarashi, T., Oishi, Y. et al. To be published.

Other PDB entries of the same protein (UniProt P63316 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SD6 1.37 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C in complex…
4GJE 1.6 Å, Crystal structure of the refolded amino-terminal domain of human cardiac troponin C in…
3SWB 1.67 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C in complex…
7SC2 1.81 Å, Crystal structure of the N-domain of cardiac muscle troponin C tethered to the switch…
4GJF 1.9 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C mutant L29Q…
4GJG 2.0 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C mutant…
4Y99 2.0 Å, Core domain of human cardiac troponin
3RV5 2.2 Å, Crystal structure of human cardiac troponin C regulatory domain in complex with cadmium…
7SC3 2.23 Å, Crystal structure of the N-domain of cardiac muscle troponin C tethered to the switch…
1WRL 2.6 Å, Crystal structure of the N-terminal domain of human cardiac troponin C in complex with…
1J1D 2.61 Å, Crystal structure of the 46kDa domain of human cardiac troponin in the Ca2+ saturated form
8FMO 2.61 Å, Complex structure of K210 deletion Troponin complex with risedronate

Browse structure collections

About this viewer

MolViewer shows 1WRK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.