7SC3: PDB entry 7SC3

Crystal structure of the N-domain of cardiac muscle troponin C tethered to the switch region of cardiac muscle troponin I (orthorhombic form). Determined by X-ray diffraction at 2.23 Å resolution. Released 1 Dec 2021.

Method: X-ray diffraction
Resolution: 2.23 Å
Organism: Homo sapiens
Chains: 1
Atoms: 785
Mol. weight: 14.23 kDa
Ligands: CA
Released: 1 Dec 2021

Explore 7SC3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7SC3 contains 6 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	6-9	4
α-helix	14-27	14
β-strand	36	1	1
α-helix	38-47	10
α-helix	54-64	11
β-strand	72	1	1
α-helix	74-87	14
α-helix	139-158	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Troponin C, slow skeletal and cardiac muscles,Troponin I, cardiac muscle chimera	A	protein	125	Homo sapiens	P19429 (AlphaFold model), P63316 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7SC3_1 Troponin C, slow skeletal and cardiac muscles,Troponin I, cardiac muscle chimera (chains A)
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRSMKDDSKGKFKRPTLRRVRISADAMMQALLGARAKGH
HHHHH

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Primary citation

X-ray structure of a human cardiac muscle troponin C/troponin I chimera in two crystal forms. Yan, C., Sack, J.S. Acta Crystallogr F Struct Biol Commun (2022) 78:17-24. DOI 10.1107/S2053230X21012395 · PubMed

Other PDB entries of the same protein (UniProt P19429 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8DZV 1.2 Å, Chicken anti-cardiac Troponin I antibody in complex with peptide
7SC2 1.81 Å, Crystal structure of the N-domain of cardiac muscle troponin C tethered to the switch…
4Y99 2.0 Å, Core domain of human cardiac troponin
1J1D 2.61 Å, Crystal structure of the 46kDa domain of human cardiac troponin in the Ca2+ saturated form
8FMO 2.61 Å, Complex structure of K210 deletion Troponin complex with risedronate
8FMT 2.8 Å, Complex structure of TnnT-R205L Troponin complex
8FMN 3.1 Å, Complex structure of K210 deletion Troponin complex
8FMM 3.11 Å, Complex structure of wild type Troponin complex
8FMR 3.24 Å, Complex structure of K210 deletion Troponin complex with ibandronate
8FMP 3.24 Å, Complex structure of K210 deletion Troponin complex with pamidronate
8FMQ 3.25 Å, Complex structure of K210 deletion Troponin complex with alendronate
1J1E 3.3 Å, Crystal structure of the 52kDa domain of human cardiac troponin in the Ca2+ saturated form

Browse structure collections

About this viewer

MolViewer shows 7SC3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.