3RV5: Human cardiac troponin C regulatory domain

Crystal structure of human cardiac troponin C regulatory domain in complex with cadmium and deoxycholic acid. Determined by X-ray diffraction at 2.2 Å resolution. Released 31 Aug 2011.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,815
Mol. weight: 46.04 kDa
Ligands: CA, DXC, CD
Released: 31 Aug 2011

Explore 3RV5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RV5 contains 21 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	4-10	7
α-helix	14-31	18
β-strand	36	1	1
α-helix	38-47	10
α-helix	54-64	11
β-strand	72	1	1
α-helix	74-84	11

Chain B: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	8-11	4
α-helix	14-31	18
β-strand	35-36	2	2
α-helix	38-47	10
α-helix	54-62	9
β-strand	72-73	2	2
α-helix	74-80	7

Chain C: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	4-10	7
α-helix	14-31	18
β-strand	35-36	2	3
α-helix	38-47	10
α-helix	54-64	11
β-strand	72-73	2	3
α-helix	74-83	10

Chain D: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	6-10	5
α-helix	14-31	18
β-strand	36	1	4
α-helix	38-47	10
α-helix	50-52	3
α-helix	54-64	11
β-strand	72	1	4
α-helix	74-81	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Troponin C, slow skeletal and cardiac muscles	A, B, C, D	protein	89	Homo sapiens	P63316 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3RV5_1 Troponin C, slow skeletal and cardiac muscles (chains A, B, C, D)
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRCMKDDS

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	3
DXC	(3ALPHA,5BETA,12ALPHA)-3,12-dihydroxycholan-24-oic acid	C24 H40 O4	5
CD	Cadmium ion	Cd	21

Primary citation

Crystal structure of cardiac troponin C regulatory domain in complex with cadmium and deoxycholic Acid reveals novel conformation. Li, A.Y., Lee, J., Borek, D. et al. J Mol Biol (2011) 413:699-711. DOI 10.1016/j.jmb.2011.08.049 · PubMed

Other PDB entries of the same protein (UniProt P63316 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SD6 1.37 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C in complex…
4GJE 1.6 Å, Crystal structure of the refolded amino-terminal domain of human cardiac troponin C in…
3SWB 1.67 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C in complex…
7SC2 1.81 Å, Crystal structure of the N-domain of cardiac muscle troponin C tethered to the switch…
4GJF 1.9 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C mutant L29Q…
4GJG 2.0 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C mutant…
4Y99 2.0 Å, Core domain of human cardiac troponin
1WRK 2.15 Å, Crystal structure of the N-terminal domain of human cardiac troponin C in complex with…
7SC3 2.23 Å, Crystal structure of the N-domain of cardiac muscle troponin C tethered to the switch…
1WRL 2.6 Å, Crystal structure of the N-terminal domain of human cardiac troponin C in complex with…
1J1D 2.61 Å, Crystal structure of the 46kDa domain of human cardiac troponin in the Ca2+ saturated form
8FMO 2.61 Å, Complex structure of K210 deletion Troponin complex with risedronate

Browse structure collections

About this viewer

MolViewer shows 3RV5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.