1WXA: Ras-binding Domain in Mouse AF-6 Protein

Solution Structure of Ras-binding Domain in Mouse AF-6 Protein. Determined by solution NMR. Released 20 Jul 2005.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 885
Mol. weight: 12.61 kDa
Released: 20 Jul 2005

Explore 1WXA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WXA contains 3 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	11-14	4	1
β-strand	26-29	4	1
α-helix	36-47	12
β-strand	57-63	7	2
β-strand	77-79	3	2
α-helix	87-92	6
α-helix	96-98	3
β-strand	101-107	7	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Afadin	A	protein	116	Mus musculus	Q9QZQ1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WXA_1 Afadin (chains A)
GSSGSSGSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAESLEKYGLEKENPKDYCIA
RVMLPPGAQHSDERGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPPSGPSSG

Primary citation

Solution Structure of Ras-binding Domain in Mouse AF-6 Protein. Zhao, C., Tomizawa, T., Koshiba, S. et al. To be published.

Other PDB entries of the same protein (UniProt Q9QZQ1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6AMB 2.5 Å, Crystal Structure of the Afadin RA1 domain in complex with HRAS
3AXA 2.78 Å, Crystal structure of afadin PDZ domain in complex with the C-terminal peptide from…
9DVA 3.1 Å, F-actin binding interface of alpha-E-catenin ABD (cadherin-catenin complex) and afadin
1WLN Solution structure of the FHA domain of mouse Afadin 6

Browse structure collections

About this viewer

MolViewer shows 1WXA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.