1WY3: Villin

Chicken villin subdomain HP-35, K65(NLE), N68H, pH7.0. Determined by X-ray diffraction at 0.95 Å resolution. Released 3 May 2005.

Method

X-ray diffraction

Resolution

0.95 Å

Chains

1

Atoms

351

Mol. weight

4.07 kDa

Released

3 May 2005

Explore 1WY3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WY3 contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Molecules and chains

>1WY3_1 Villin (chains A)
LSDEDFKAVFGMTRSAFANLPLWLQQHLKKEKGLF

Primary citation

High-resolution x-ray crystal structures of the villin headpiece subdomain, an ultrafast folding protein. Chiu, T.K., Kubelka, J., Herbst-Irmer, R. et al. Proc Natl Acad Sci U S A (2005) 102:7517-7522. DOI 10.1073/pnas.0502495102 · PubMed

Related structures

Other PDB entries of the same protein (UniProt P02640 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 1YRI 1.0 Å, Chicken villin subdomain HP-35, N68H, pH6.4
• 3TRV 1.0 Å, Crystal structure of quasiracemic villin headpiece subdomain containing (F5Phe17)…
• 2F4K 1.05 Å, Chicken villin subdomain HP-35, K65(NLE), N68H, K70(NLE), PH9
• 1YRF 1.07 Å, Chicken villin subdomain HP-35, N68H, pH6.7
• 5I1S 1.12 Å, Villin headpiece subdomain with a Lys30 to APC substitution
• 5I1N 1.3 Å, Villin headpiece subdomain with a Gln26 to beta-3-homoglutamine substitution
• 5I1O 1.35 Å, Villin headpiece subdomain with a Gln26 to ACPC substitution
• 1YU5 1.4 Å, Crystal Structure of the Headpiece Domain of Chicken Villin
• 2RJY 1.4 Å, Crystal structure of villin headpiece, P21 21 21 space group
• 5I1P 1.4 Å, Villin headpiece subdomain with a Lys30 to beta-3-homolysine substitution
• 1YU8 1.45 Å, Crystal Structure of the R37A Mutant of Villin Headpiece
• 2RJV 1.45 Å, Crystal structure of the H41Y mutant of villin headpiece, P 21 21 21 space group

Browse structure collections

About this viewer

MolViewer shows 1WY3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.