1WZV: UbcH8

Crystal Structure of UbcH8. Determined by X-ray diffraction at 2.1 Å resolution. Released 22 Mar 2005.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,592
Mol. weight: 35.88 kDa
Released: 22 Mar 2005

Explore 1WZV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WZV contains 16 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	3-15	13
β-strand	21-26	6	1
β-strand	33-38	6	1
α-helix	45-47	3
β-strand	48-49	2	2
β-strand	50-55	6	1
β-strand	66-69	4	1
β-strand	75	1	3
β-strand	78	1	3
β-strand	83	1	1
α-helix	87-89	3
α-helix	100-112	13
α-helix	122-130	9
α-helix	132-146	15
α-helix	147	1
β-strand	148-149	2	2
α-helix	150	1

Chain B: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	3-15	13
β-strand	21-26	6	4
β-strand	33-38	6	4
α-helix	45-47	3
β-strand	49	1	5
β-strand	50-55	6	4
β-strand	66-69	4	4
α-helix	87-89	3
α-helix	100-112	13
α-helix	122-130	9
α-helix	132-146	15
α-helix	147	1
β-strand	148	1	5
α-helix	149-150	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-conjugating enzyme E2 L6	A, B	protein	155	Homo sapiens	O14933 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1WZV_1 Ubiquitin-conjugating enzyme E2 L6 (chains A, B)
GSHMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFP
PEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIR
EPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS

Primary citation

Crystal Structure of UbcH8. Mizushima, T., Suzuki, M., Teshima, N. et al. To be published.

Other PDB entries of the same protein (UniProt O14933 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WZW 2.4 Å, Crystal Structure of UbcH8
9LW4 2.7 Å, UbCh8-ISG15 complex
8SE9 3.2 Å, Cryo-EM structure of a double loaded human UBA7-UBE2L6-ISG15 thioester mimetic complex…
8SEB 3.24 Å, Cryo-EM structure of a single loaded human UBA7-UBE2L6-ISG15 adenylate complex
8SV8 3.38 Å, Cryo-EM structure of a double loaded human UBA7-UBE2L6-ISG15 thioester mimetic complex…
8SEA 3.4 Å, Cryo-EM structure of a double loaded human UBA7-UBE2L6-ISG15 thioester mimetic complex…
8OIF 3.5 Å, Structure of the UBE1L activating enzyme bound to ISG15 and UBE2L6
2KJH NMR based structural model of the UBCH8-UBIQUITIN complex

Browse structure collections

About this viewer

MolViewer shows 1WZV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.