1X4A: RRM domain in splicing factor SF2

Solution structure of RRM domain in splicing factor SF2. Determined by solution NMR. Released 14 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 828
Mol. weight: 11.76 kDa
Released: 14 Nov 2005

Explore 1X4A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1X4A contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	24-28	5	1
α-helix	36-43	8
α-helix	44-46	3
β-strand	49-54	6	1
β-strand	64-68	5	1
α-helix	71-81	11
β-strand	85-86	2	2
β-strand	89-90	2	2
β-strand	92-94	3	1
α-helix	95-97	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor) variant	A	protein	109	Homo sapiens	Q07955 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1X4A_1 splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor) variant (chains A)
GSSGSSGMSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGG
PPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGSGPSSG

Primary citation

Solution structure of RRM domain in splicing factor SF2. He, F., Muto, Y., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q07955 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4C0O 2.56 Å, Transportin 3 in complex with phosphorylated ASF/SF2
3BEG 2.9 Å, Crystal structure of SR protein kinase 1 complexed to its substrate ASF/SF2
8QO9 5.29 Å, Cryo-EM structure of a human spliceosomal B complex protomer
7ABG 7.8 Å, Human pre-Bact-1 spliceosome
9R8V 8.5 Å, Cryo-EM structure of the human pre-Bact-OTS complex (whole map)
2M7S NMR structure of RNA recognition motif 2 (RRM2) of Homo sapiens splicing factor,…
2M8D Structure of SRSF1 RRM2 in complex with the RNA 5'-UGAAGGAC-3'
2O3D Structure of human SF2/ASF RNA recognition motif 2 (RRM2)
6HPJ Structure of human SRSF1 RRM1 bound to AACAAA RNA

Browse structure collections

About this viewer

MolViewer shows 1X4A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.