6HPJ: Human SRSF1 RRM1

Structure of human SRSF1 RRM1 bound to AACAAA RNA. Determined by solution NMR. Released 18 Nov 2020.

Method: Solution NMR
Organisms: Streptococcus sp. group G, Homo sapiens
Chains: 2
Atoms: 801
Mol. weight: 19.86 kDa
Released: 18 Nov 2020

Explore 6HPJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6HPJ contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	17-21	5	1
α-helix	31-40	10
β-strand	44-48	5	1
β-strand	56-60	5	1
α-helix	64-74	11
β-strand	78-79	2	2
β-strand	82-83	2	2
β-strand	85-87	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin G-binding protein G,Serine/arginine-rich splicing factor 1	B	protein	161	Streptococcus sp. group G, Homo sapiens	P19909 (AlphaFold model), Q07955 (AlphaFold model)
RNA (5'-r(apapcpapapa)-3')	A	RNA	6	Homo sapiens

Sequence of entity 1 (B), FASTA

>6HPJ_1 Immunoglobulin G-binding protein G,Serine/arginine-rich splicing factor 1 (chains B)
MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSHH
HHHHMSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFSKYGAIRDIDLKNRRGGPPF
AFVEFEDPRDAEDAVSGRDGYDYDGYRLRVEFPRSGRGTGR

Sequence of entity 2 (A), FASTA

>6HPJ_2 RNA (5'-R(*AP*AP*CP*AP*AP*A)-3') (chains A)
AACAAA

Primary citation

Structure of SRSF1 RRM1 bound to RNA reveals an unexpected bimodal mode of interaction and explains its involvement in SMN1 exon7 splicing. Clery, A., Krepl, M., Nguyen, C.K.X. et al. Nat Commun (2021) 12:428-428. DOI 10.1038/s41467-020-20481-w · PubMed

Other PDB entries of the same protein (UniProt P19909 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FIL 0.88 Å, Structural and energetic determinants for hyperstable variants of GB1 obtained from…
2QMT 1.05 Å, Crystal Polymorphism of Protein GB1 Examined by Solid-state NMR and X-ray Diffraction
9I2I 1.08 Å, X-ray structure of the B1 domain of streptococcal protein G triple mutant T2Q, N8D, and…
6CHE 1.1 Å, Selenomethionine mutant (A34Sem) of protein GB1 examined by X-ray diffraction
6CPZ 1.12 Å, Selenomethionine mutant (I6Sem) of protein GB1 examined by X-ray diffraction
2GI9 1.14 Å, Backbone Conformational Constraints in a Microcrystalline U-15N-Labeled Protein by 3D…
6C9O 1.2 Å, Selenomethionine mutant (V29Sem) of protein GB1 examined by X-ray diffraction
6CTE 1.2 Å, 77Se-NMR probes the protein environment of selenomethionine
6OC7 1.3 Å, HMP42 Fab in complex with Protein G
6NLA 1.34 Å, Crystal structure of de novo designed metal-controlled dimer of B1…
2ON8 1.35 Å, Gbeta1 stabilization by in vitro evolution and computational design
12LO 1.37 Å, X-ray crystal structure of Protein GB1 mutant K13A

Browse structure collections

About this viewer

MolViewer shows 6HPJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.