Solution structure of the fibronectin type-III domain of human protein tyrosine phosphatase, receptor type, D isoform 4 variant. Determined by solution NMR. Released 17 Nov 2005.
Explore 1X5Z in 3D Show helices and sheets RCSB PDB PDBe
1X5Z contains 2 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 22-27 | 6 | 1 |
| β-strand | 33-39 | 7 | 1 |
| β-strand | 48-51 | 4 | 2 |
| β-strand | 53 | 1 | 3 |
| β-strand | 54-55 | 2 | 4 |
| β-strand | 62 | 1 | 3 |
| β-strand | 65-66 | 2 | 2 |
| β-strand | 71-75 | 5 | 1 |
| β-strand | 82-85 | 4 | 4 |
| β-strand | 87-90 | 4 | 2 |
| β-strand | 95-98 | 4 | 2 |
| β-strand | 102-105 | 4 | 4 |
| α-helix | 106-107 | 2 | |
| α-helix | 109-111 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Receptor-type tyrosine-protein phosphatase delta | A | protein | 115 | Homo sapiens | P23468 (AlphaFold model) |
>1X5Z_1 Receptor-type tyrosine-protein phosphatase delta (chains A) GSSGSSGDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPRSDTIANYELVYKDGEHGE EQRITIEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQSSGPSSG
Solution structure of the fibronectin type-III domain of human protein tyrosine phosphatase, receptor type, D isoform 4 variant. Yoneyama, M., Saito, K., Tochio, N. et al. To be published.
Other PDB entries of the same protein (UniProt P23468 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1X5Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.