1XEQ: Nonstructural protein NS1

Crystal tructure of RNA binding domain of influenza B virus non-structural protein. Determined by X-ray diffraction at 2.1 Å resolution. Released 20 Sept 2005.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Influenza B virus (B/Lee/40)
Chains: 2
Atoms: 1,676
Mol. weight: 25.28 kDa
Released: 20 Sept 2005

Explore 1XEQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1XEQ contains 7 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	16-36	21
α-helix	42-64	23
α-helix	68-70	3
α-helix	74-88	15

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	15-35	21
α-helix	42-64	23
α-helix	74-89	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nonstructural protein NS1	A, B	protein	103	Influenza B virus (B/Lee/40)	P03502 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1XEQ_1 Nonstructural protein NS1 (chains A, B)
MADNMTTTQIEVGPGATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIK
THNKSEPENKRMSLEERKAIGVKMMKVLLFMDPSAGIEGFEPY

Primary citation

Conserved surface features form the double-stranded RNA binding site of non-structural protein 1 (NS1) from influenza A and B viruses. Yin, C., Khan, J.A., Swapna, G.V. et al. J Biol Chem (2007) 282:20584-20592. DOI 10.1074/jbc.M611619200 · PubMed

Other PDB entries of the same protein (UniProt P03502 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7S8S 1.87 Å, Crystal Structure of HLA A*1101 in complex with RVLVNGTFLK, an 10-mer epitope from…
3RT3 2.01 Å, Complex of influenza virus protein with host anti-viral factor
3SDL 2.29 Å, Crystal structure of human ISG15 in complex with NS1 N-terminal region from influenza B…
3R66 2.3 Å, Crystal structure of human ISG15 in complex with NS1 N-terminal region from influenza…
6JH0 2.4 Å, Crystal structure of cISG15/NS1B complex
6J62 2.49 Å, Crystal structure of mISG15/NS1B complex
6JH1 3.0 Å, Crystal structure of bISG15/NS1B complex

Browse structure collections

About this viewer

MolViewer shows 1XEQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.