1XFH: Proton glutamate symport protein

Structure of glutamate transporter homolog from Pyrococcus horikoshii. Determined by X-ray diffraction at 3.5 Å resolution. Released 26 Oct 2004.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: Pyrococcus horikoshii
Chains: 3
Atoms: 8,652
Mol. weight: 133.93 kDa
Released: 26 Oct 2004

Explore 1XFH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1XFH contains 79 α-helices and 6 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	13-33	21
α-helix	36-42	7
α-helix	46-55	10
α-helix	58-67	10
α-helix	74-78	5
α-helix	79-106	28
α-helix	131-134	4
α-helix	135-137	3
α-helix	142-146	5
β-strand	147	1	1
β-strand	149	1	1
α-helix	153-169	17
α-helix	175-200	26
α-helix	205-220	16
α-helix	221-223	3
α-helix	226-242	17
α-helix	243-248	6
α-helix	249-252	4
α-helix	258-264	7
α-helix	266-275	10
α-helix	278-290	13
α-helix	299-302	4
α-helix	304-306	3
α-helix	312-328	17
α-helix	339-351	13
α-helix	364-370	7
α-helix	379-386	8
α-helix	390-397	8
α-helix	400-414	15

Chain B: 25 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	13-31	19
α-helix	36-42	7
α-helix	44-55	12
α-helix	58-67	10
α-helix	74-78	5
α-helix	79-106	28
α-helix	131-134	4
α-helix	135-137	3
α-helix	142-146	5
β-strand	147	1	2
β-strand	149	1	2
α-helix	153-169	17
α-helix	174-200	27
α-helix	205-220	16
α-helix	221-223	3
α-helix	228-241	14
α-helix	242-248	7
α-helix	249-252	4
α-helix	258-264	7
α-helix	266-275	10
α-helix	278-290	13
α-helix	299-306	8
α-helix	312-327	16
α-helix	339-351	13
α-helix	363-370	8
α-helix	377-386	10
α-helix	390-415	26

Chain C: 27 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	13-32	20
α-helix	36-40	5
α-helix	44-67	24
α-helix	74-78	5
α-helix	79-106	28
α-helix	113-114	2
α-helix	131-134	4
α-helix	135-137	3
α-helix	142-146	5
β-strand	147	1	3
β-strand	149	1	3
α-helix	153-169	17
α-helix	174-200	27
α-helix	205-216	12
α-helix	217-221	5
α-helix	226-241	16
α-helix	242-248	7
α-helix	249-253	5
α-helix	258-264	7
α-helix	266-274	9
α-helix	278-290	13
α-helix	299-306	8
α-helix	312-327	16
α-helix	339-351	13
α-helix	361-363	3
α-helix	364-370	7
α-helix	378-386	9
α-helix	387-389	3
α-helix	390-415	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
proton glutamate symport protein	A, B, C	protein	422	Pyrococcus horikoshii	O59010 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1XFH_1 proton glutamate symport protein (chains A, B, C)
MGLYRKYIEYPVLQKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMP
IVFASLVVGAASISPARLGRVGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGGQ
QFQPHQAPPLVHILLDIVPTNPFGALANGQVLPTIFFAIILGIAITYLMNSENEKVRKSA
ETLLDAINGLAEAMYKIVNGVMQYAPIGVFALIAYVMAEQGVHVVGELAKVTAAVYVGLT
LQILLVYFVLLKIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAKEMGISEGIYS
FTLPLGATINMDGTALYQGVCTFFIANALGSHLTVGQQLTIVLTAVLASIGTAGVPGAGA
IMLAMVLHSVGLPLTDPNVAAAYAMILGIDAILDMGRTMVNVTGDLTGTAIVAKTEGTLV
PR

Primary citation

Structure of a glutamate transporter homologue from Pyrococcus horikoshii. Yernool, D., Boudker, O., Jin, Y. et al. Nature (2004) 431:811-818. DOI 10.1038/nature03018 · PubMed

Other PDB entries of the same protein (UniProt O59010 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7RCP 2.2 Å, GltPh mutant (S279E/D405N) in complex with aspartate and sodium ions
7AHK 2.5 Å, Crystal structure of the outward-facing state of the substrate-free Na+-only bound…
7UG0 2.55 Å, TBOA-bound GltPh RSMR mutant in IFS state
9BH2 2.7 Å, Apo GltPh, outward-facing state
7UGJ 2.81 Å, TBOA-bound GltPh RSMR mutant in OFS state
7UGV 2.94 Å, Asp-bound GltPh RSMR mutant in IFS-A2 state
7UGD 2.95 Å, Asp-bound GltPh RSMR mutant in IFS-A1 state
2NWL 2.96 Å, Crystal structure of GltPh in complex with L-Asp
7UGX 2.96 Å, Asp-bound GltPh RSMR mutant in IFS-B1 state
7UH3 2.99 Å, Asp-bound GltPh RSMR mutant in iOFS state
6X15 3.05 Å, Inward-facing state of the glutamate transporter homologue GltPh in complex with…
6UWF 3.08 Å, GltPh in complex with L-aspartate and sodium ions in outward-facing state

Browse more

1XFH is part of these collections:

About this viewer

MolViewer shows 1XFH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.