Thermostabilization of the bacillus circulans xylanase, by the introduction of disulfide bonds. Determined by X-ray diffraction at 1.6 Å resolution. Released 20 Dec 1994.
Explore 1XNC in 3D Show helices and sheets RCSB PDB PDBe
1XNC contains 3 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-10 | 6 | 1 |
| β-strand | 15-20 | 6 | 2 |
| β-strand | 25-31 | 7 | 2 |
| β-strand | 35-42 | 8 | 1 |
| β-strand | 50-61 | 12 | 2 |
| β-strand | 64-73 | 10 | 1 |
| β-strand | 77-85 | 9 | 1 |
| β-strand | 93-100 | 8 | 1 |
| β-strand | 103-116 | 14 | 1 |
| β-strand | 122-132 | 11 | 1 |
| α-helix | 135-137 | 3 | |
| β-strand | 142-145 | 4 | 2 |
| α-helix | 146-155 | 10 | |
| α-helix | 159-161 | 3 | |
| β-strand | 163-174 | 12 | 1 |
| β-strand | 177-184 | 8 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Xylanase | A | protein | 185 | Bacillus circulans | P09850 (AlphaFold model) |
>1XNC_1 XYLANASE (chains A) ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAP NGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKCDGGTYDIYTTTRYNAPSIDG DRTTFTQYWSVRQSKRPTGSNATITFTCHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSS NVTVW
Thermostabilization of the Bacillus circulans xylanase by the introduction of disulfide bonds. Wakarchuk, W.W., Sung, W.L., Campbell, R.L. et al. Protein Eng (1994) 7:1379-1386. DOI 10.1093/protein/7.11.1379 · PubMed
Other PDB entries of the same protein (UniProt P09850 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1XNC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.