1XWD: Human Follicle Stimulating Hormone

Crystal Structure of Human Follicle Stimulating Hormone Complexed with its Receptor. Determined by X-ray diffraction at 2.92 Å resolution. Released 25 Jan 2005.

Method: X-ray diffraction
Resolution: 2.92 Å
Organism: Homo sapiens
Chains: 6
Atoms: 7,031
Mol. weight: 105.33 kDa
Ligands: NAG
Released: 25 Jan 2005

Explore 1XWD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1XWD contains 6 α-helices and 72 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	8	1
β-strand	9	1	1
β-strand	11-14	4	1
β-strand	20	1	2
β-strand	23	1	2
β-strand	26-38	13	1
α-helix	39-40	2
α-helix	41-44	4
β-strand	53-57	5	1
β-strand	59-70	12	3
β-strand	74-85	12	3
β-strand	91	1	4

Chain B: 0 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	4-14	11	1
β-strand	19-35	17	1
β-strand	50-63	14	5
β-strand	66	1	6
β-strand	69	1	6
β-strand	72-85	14	5
β-strand	87	1	4
β-strand	92-95	4	1

Chain C: 0 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	23-25	3	7
β-strand	29-33	5	7
β-strand	50-54	5	7
β-strand	60-61	2	8
β-strand	74-78	5	7
β-strand	85-86	2	8
β-strand	91-92	2	9
β-strand	99-103	5	7
β-strand	110-111	2	8
β-strand	116-117	2	9
β-strand	124-128	5	7
β-strand	143	1	10
β-strand	147-152	6	7
β-strand	159-160	2	11
β-strand	169	1	10
β-strand	173-176	4	7
β-strand	184-185	2	11
β-strand	195-199	5	7
β-strand	222-224	3	7
β-strand	243-245	3	7
β-strand	249-250	2	7

Chain D: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	11-14	4	12
β-strand	26-38	13	12
α-helix	39-40	2
α-helix	43-45	3
β-strand	53-57	5	12
β-strand	59-69	11	13
β-strand	75-85	11	13
β-strand	91	1	14

Chain E: 1 helix, 6 β-strands

Element	Residues	Length	Sheet
β-strand	4-13	10	12
α-helix	15-17	3
β-strand	20-35	16	12
β-strand	50-63	14	15
β-strand	72-85	14	15
β-strand	87	1	14
β-strand	92-95	4	12

Chain F: 0 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	24-25	2	16
β-strand	29-33	5	16
β-strand	50-54	5	16
β-strand	60-61	2	17
β-strand	74-78	5	16
β-strand	85-86	2	17
β-strand	91-92	2	18
β-strand	99-105	7	16
β-strand	110-111	2	17
β-strand	116-117	2	18
β-strand	124-130	7	16
β-strand	143	1	19
β-strand	147-152	6	16
β-strand	159-160	2	20
β-strand	169	1	19
β-strand	172-176	5	16
β-strand	184-185	2	20
β-strand	193	1	21
β-strand	194-199	6	16
β-strand	217	1	21
β-strand	222-224	3	16
β-strand	243-245	3	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glycoprotein hormones alpha chain	A, D	protein	92	Homo sapiens	P01215 (AlphaFold model)
Follitropin beta chain	B, E	protein	111	Homo sapiens	P01225 (AlphaFold model)
Follicle stimulating hormone receptor	C, F	protein	252	Homo sapiens	P23945 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>1XWD_1 Glycoprotein hormones alpha chain (chains A, D)
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC
VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Sequence of entity 2 (B, E), FASTA

>1XWD_2 Follitropin beta chain (chains B, E)
NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYET
VRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

Sequence of entity 3 (C, F), FASTA

>1XWD_3 Follicle stimulating hormone receptor (chains C, F)
GCHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIE
ISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLP
DVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLD
ELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLP
TLEKLVALMEAS

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	6

Water and common crystallization additives (SO4) are not listed.

Primary citation

Structure of human follicle-stimulating hormone in complex with its receptor. Fan, Q.R., Hendrickson, W.A. Nature (2005) 433:269-277. DOI 10.1038/nature03206 · PubMed

Other PDB entries of the same protein (UniProt P01215 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9YXD 2.29 Å, Crystal structure of recombinant human follicle stimulating hormone in complex with an…
7UTZ 2.4 Å, Human thyrotropin analog TR1402 bound to human Thyrotropin receptor in complex with…
4AY9 2.5 Å, Structure of follicle-stimulating hormone in complex with the entire ectodomain of its…
1HCN 2.6 Å, Structure of human chorionic gonadotropin at 2.6 Å resolution from mad analysis of the…
8I2G 2.8 Å, FSHR-Follicle stimulating hormone-compound 716340-Gs complex
4MQW 2.9 Å, Structure of follicle-stimulating hormone in complex with the entire ectodomain of its…
7T9I 2.9 Å, Native human TSH bound to human Thyrotropin receptor in complex with miniGs399…
7XW5 2.96 Å, TSHR-thyroid stimulating hormone-Gs-ML109 complex
1FL7 3.0 Å, Human follicle stimulating hormone
1HRP 3.0 Å, Crystal structure of human chorionic gonadotropin
7FIH 3.2 Å, luteinizing hormone/choriogonadotropin receptor(S277I)-chorionic…
1QFW 3.5 Å, Ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti…

Browse structure collections

About this viewer

MolViewer shows 1XWD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.