1Y2O: N-terminal domain IRSp53/BAIAP2

Structure of N-terminal domain IRSp53/BAIAP2. Determined by X-ray diffraction at 2.2 Å resolution. Released 15 Feb 2005.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,164
Mol. weight: 57.96 kDa
Released: 15 Feb 2005

Explore 1Y2O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Y2O contains 17 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	2-19	18
α-helix	20-24	5
α-helix	25-64	40
α-helix	70-96	27
α-helix	97-102	6
α-helix	103-149	47
α-helix	158-229	72
α-helix	238-246	9

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	3-19	17
α-helix	20-24	5
α-helix	25-65	41
α-helix	70-96	27
α-helix	97-102	6
α-helix	103-144	42
α-helix	154-229	76
α-helix	235-237	3
α-helix	238-247	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BAI1-associated protein 2 isoform 1	A, B	protein	250	Homo sapiens	Q9UQB8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1Y2O_1 BAI1-associated protein 2 isoform 1 (chains A, B)
MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMG
ELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAAL
KKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVS
DGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERA
VQLMQQVASN

Primary citation

Structural basis of filopodia formation induced by the IRSp53/MIM homology domain of human IRSp53. Millard, T.H., Bompard, G., Heung, M.-Y. et al. EMBO J (2005) 24:240-250. DOI 10.1038/sj.emboj.7600535 · PubMed

Other PDB entries of the same protein (UniProt Q9UQB8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZEG 1.09 Å, Structure of PP1-IRSp53 chimera [PP1(7-304) + linker (G/S)x9 + IRSp53(449-465)] bound to…
6ZEI 1.39 Å, Structure of PP1-IRSp53 S455E chimera [PP1(7-304) + linker (G/S)x9 + IRSp53(449-465)]…
3RNJ 1.5 Å, Crystal structure of the SH3 domain from IRSp53 (BAIAP2)
4JS0 1.9 Å, Complex of Cdc42 with the CRIB-PR domain of IRSp53
6BCR 1.99 Å, Complex of 14-3-3 theta with an IRSp53 peptide phosphorylated at T340
2YKT 2.11 Å, Crystal structure of the I-BAR domain of IRSp53 (BAIAP2) in complex with an EHEC derived…
6BCY 2.3 Å, Complex of 14-3-3 theta with an IRSp53 peptide phosphorylated at T360
6BD1 2.35 Å, Complex of 14-3-3 theta with an IRSp53 peptide phosphorylated at S366
1WDZ 2.63 Å, Crystal structure of RCB domain of IRSp53
6BQT 2.8 Å, Complex of 14-3-3 theta with an IRSp53 peptide doubly-phosphorylated at T340 and T360
6BD2 2.9 Å, Complex of 14-3-3 theta with an IRSp53 peptide doubly-phosphorylated at T340 and S366

Browse structure collections

About this viewer

MolViewer shows 1Y2O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.