1YDL: General transcription factor IIH, polypeptide 5

Name: PDB 1YDL: Crystal Structure of the Human TFIIH, Northeast Structural Genomics Target HR2045.
Published: 2005-02-08
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal Structure of the Human TFIIH, Northeast Structural Genomics Target HR2045. Determined by X-ray diffraction at 2.3 Å resolution. Released 8 Feb 2005.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 600
Mol. weight: 9.23 kDa
Released: 8 Feb 2005

Explore 1YDL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1YDL contains 3 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	1
α-helix	14-25	12
β-strand	34-37	4	1
β-strand	42-45	4	1
α-helix	49-59	11
α-helix	62-63	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
general transcription factor IIH, polypeptide 5	A	protein	79	Homo sapiens	Q6ZYL4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1YDL_1 general transcription factor IIH, polypeptide 5 (chains A)
MGHHHHHHSHGTRKGMLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNV
LQERVGELMDQNAFSLTQK

Primary citation

Crystal Structure of the Human TFIIH, Northeast Structural Genomics Target HR2045. Forouhar, F., Edstrom, W., Xiao, R. et al. To be published.

Other PDB entries of the same protein (UniProt Q6ZYL4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NVV 2.9 Å, XPB-containing part of TFIIH in a post-translocated state (with ADP-BeF3)
28JM 3.29 Å, Cryo-EM structure of the human holo-TFIIH and XPC initial encounter complex
7EGB 3.3 Å, TFIID-based holo PIC on SCP promoter
8EBU 3.3 Å, XPC release from Core7-XPA-DNA (Cy5)
9PD3 3.3 Å, NER dual incision complex - DuIS
28JS 3.32 Å, Cryo-EM structure of the human holo-TFIIH-XPC complex bound to bulky lesion-mimic DNA…
9PD4 3.4 Å, NER dual incision complex - DuIM
6RO4 3.5 Å, Structure of the core TFIIH-XPA-DNA complex
7AD8 3.5 Å, Core TFIIH-XPA-DNA complex with modelled p62 subunit
9XYU 3.5 Å, NER complex - C7CAD.ATP
28KE 3.6 Å, Cryo-EM structure of the human holo-TFIIH-XPC-XPA complex bound to bulky lesion-mimic DNA
8EBX 3.6 Å, XPA repositioning Core7 of TFIIH relative to XPC-DNA lesion (AP)

Browse structure collections

About this viewer

MolViewer shows 1YDL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.