6RO4: Core TFIIH-XPA-DNA complex
Structure of the core TFIIH-XPA-DNA complex. Determined by electron microscopy at 3.5 Å resolution. Released 3 Jul 2019.
- Method
- Electron microscopy
- Resolution
- 3.5 Å
- Organism
- Homo sapiens
- Chains
- 9
- Atoms
- 19,827
- Mol. weight
- 377.91 kDa
- Ligands
- SF4, ZN
- Released
- 3 Jul 2019
Explore 6RO4 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6RO4 contains 118 α-helices and 95 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 26 helices, 31 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 78 | 1 | 1 |
| β-strand | 84-87 | 4 | 1 |
| α-helix | 94-100 | 7 | |
| β-strand | 105-108 | 4 | 1 |
| β-strand | 113-117 | 5 | 1 |
| α-helix | 120-128 | 9 | |
| α-helix | 133-139 | 7 | |
| α-helix | 141-143 | 3 | |
| α-helix | 153-158 | 6 | |
| β-strand | 167-170 | 4 | 2 |
| β-strand | 175-179 | 5 | 2 |
| α-helix | 185-188 | 4 | |
| β-strand | 198 | 1 | 2 |
| β-strand | 268-272 | 5 | 2 |
| α-helix | 278-286 | 9 | |
| β-strand | 295 | 1 | 3 |
| α-helix | 315-317 | 3 | |
| α-helix | 320-327 | 8 | |
| β-strand | 333 | 1 | 3 |
| β-strand | 337-339 | 3 | 4 |
| α-helix | 348-357 | 10 | |
| β-strand | 361-364 | 4 | 4 |
| α-helix | 370-381 | 12 | |
| β-strand | 389-391 | 3 | 4 |
| β-strand | 405-407 | 3 | 4 |
| α-helix | 421-430 | 10 | |
| β-strand | 435 | 1 | 5 |
| β-strand | 438-441 | 4 | 4 |
| α-helix | 443-445 | 3 | |
| α-helix | 454-457 | 4 | |
| β-strand | 460 | 1 | 5 |
| β-strand | 463-467 | 5 | 4 |
| α-helix | 480-483 | 4 | |
| β-strand | 487-490 | 4 | 4 |
| α-helix | 495-498 | 4 | |
| β-strand | 505 | 1 | 6 |
| β-strand | 508-510 | 3 | 7 |
| β-strand | 511-512 | 2 | 8 |
| α-helix | 513-515 | 3 | |
| α-helix | 518-522 | 5 | |
| α-helix | 530-533 | 4 | |
| α-helix | 538-552 | 15 | |
| β-strand | 558-559 | 2 | 7 |
| β-strand | 562 | 1 | 7 |
| α-helix | 566-572 | 7 | |
| β-strand | 579-580 | 2 | 9 |
| α-helix | 587-597 | 11 | |
| β-strand | 606-607 | 2 | 9 |
| β-strand | 622-626 | 5 | 7 |
| α-helix | 635-637 | 3 | |
| α-helix | 640-643 | 4 | |
| β-strand | 657 | 1 | 6 |
| β-strand | 658-662 | 5 | 7 |
| β-strand | 663-664 | 2 | 8 |
| α-helix | 669-675 | 7 | |
| β-strand | 688-690 | 3 | 7 |
| α-helix | 707-716 | 10 | |
Chain B: 31 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-4 | 3 | 12 |
| β-strand | 9-11 | 3 | 12 |
| α-helix | 19-34 | 16 | |
| β-strand | 38-41 | 4 | 13 |
| α-helix | 48-62 | 15 | |
| β-strand | 69-73 | 5 | 13 |
| α-helix | 77-98 | 22 | |
| β-strand | 106-108 | 3 | 13 |
| α-helix | 127-138 | 12 | |
| α-helix | 145-147 | 3 | |
| α-helix | 156-159 | 4 | |
| α-helix | 177-187 | 11 | |
| α-helix | 191-197 | 7 | |
| β-strand | 204-207 | 4 | 13 |
| α-helix | 209-211 | 3 | |
| α-helix | 215-221 | 7 | |
| β-strand | 229-234 | 6 | 13 |
| α-helix | 240-245 | 6 | |
| β-strand | 249-252 | 4 | 14 |
| α-helix | 253-270 | 18 | |
| α-helix | 327-344 | 18 | |
| β-strand | 351-352 | 2 | 14 |
| α-helix | 357-360 | 4 | |
| α-helix | 369-372 | 4 | |
| α-helix | 375-386 | 12 | |
| α-helix | 395-409 | 15 | |
| β-strand | 414-419 | 6 | 14 |
| β-strand | 432-437 | 6 | 14 |
| α-helix | 447-450 | 4 | |
| β-strand | 453-458 | 6 | 13 |
| α-helix | 467-470 | 4 | |
| β-strand | 480 | 1 | 13 |
| β-strand | 490-493 | 4 | 15 |
| β-strand | 495 | 1 | 16 |
| α-helix | 514-527 | 14 | |
| β-strand | 535-539 | 5 | 15 |
| α-helix | 543-552 | 10 | |
| α-helix | 558-564 | 7 | |
| β-strand | 566-569 | 4 | 15 |
| α-helix | 574-587 | 14 | |
| β-strand | 594-599 | 6 | 15 |
| α-helix | 603-606 | 4 | |
| β-strand | 617-620 | 4 | 15 |
| α-helix | 633-642 | 10 | |
| α-helix | 648-656 | 9 | |
| α-helix | 665-667 | 3 | |
| β-strand | 675-679 | 5 | 15 |
| α-helix | 682-685 | 4 | |
| α-helix | 687-690 | 4 | |
| α-helix | 695-698 | 4 | |
| β-strand | 708 | 1 | 16 |
| α-helix | 710-724 | 15 | |
Chain C: 27 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 19-24 | 6 | |
| α-helix | 28-34 | 7 | |
| α-helix | 39-46 | 8 | |
| α-helix | 52-58 | 7 | |
| α-helix | 65-67 | 3 | |
| α-helix | 72-74 | 3 | |
| β-strand | 75 | 1 | 18 |
| α-helix | 81-92 | 12 | |
| β-strand | 96 | 1 | 25 |
| α-helix | 109 | 1 | |
| β-strand | 110 | 1 | 25 |
| α-helix | 111 | 1 | |
| α-helix | 112-121 | 10 | |
| α-helix | 146-160 | 15 | |
| α-helix | 161-163 | 3 | |
| α-helix | 173-182 | 10 | |
| α-helix | 198-204 | 7 | |
| α-helix | 208-220 | 13 | |
| α-helix | 223-226 | 4 | |
| α-helix | 230-240 | 11 | |
| α-helix | 256-268 | 13 | |
| α-helix | 285-288 | 4 | |
| β-strand | 308-309 | 2 | 26 |
| β-strand | 314-317 | 4 | 26 |
| α-helix | 322-328 | 7 | |
| β-strand | 333-338 | 6 | 26 |
| β-strand | 341-345 | 5 | 26 |
| α-helix | 348-355 | 8 | |
| α-helix | 361-370 | 10 | |
| α-helix | 381 | 1 | |
| α-helix | 385-399 | 15 | |
| β-strand | 402 | 1 | 11 |
| β-strand | 407-409 | 3 | 10 |
| α-helix | 417-420 | 4 | |
| β-strand | 431-433 | 3 | 10 |
| β-strand | 441-443 | 3 | 10 |
| α-helix | 445-447 | 3 | |
| α-helix | 452-457 | 6 | |
Chain D: 16 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 59-66 | 8 | 22 |
| α-helix | 69-72 | 4 | |
| α-helix | 80-98 | 19 | |
| β-strand | 103-109 | 7 | 22 |
| β-strand | 114-121 | 8 | 22 |
| α-helix | 128-131 | 4 | |
| α-helix | 133-136 | 4 | |
| α-helix | 146-154 | 9 | |
| β-strand | 164-171 | 8 | 22 |
| α-helix | 182-184 | 3 | |
| α-helix | 185-191 | 7 | |
| β-strand | 195-200 | 6 | 22 |
| α-helix | 206-215 | 10 | |
| β-strand | 219-221 | 3 | 22 |
| α-helix | 225-233 | 9 | |
| α-helix | 238-239 | 2 | |
| β-strand | 279-280 | 2 | 21 |
| β-strand | 282 | 1 | 23 |
| β-strand | 283 | 1 | 20 |
| β-strand | 290 | 1 | 24 |
| β-strand | 297 | 1 | 24 |
| α-helix | 303 | 1 | |
| β-strand | 304 | 1 | 23 |
| α-helix | 305 | 1 | |
| β-strand | 311 | 1 | 23 |
| α-helix | 315-319 | 5 | |
| α-helix | 327-330 | 4 | |
| α-helix | 369-374 | 6 | |
| α-helix | 375-379 | 5 | |
Chain E: 11 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 10-16 | 7 | 17 |
| α-helix | 19-28 | 10 | |
| α-helix | 35-48 | 14 | |
| β-strand | 56-62 | 7 | 17 |
| β-strand | 69 | 1 | 17 |
| α-helix | 105-118 | 14 | |
| α-helix | 133-147 | 15 | |
| β-strand | 159-165 | 7 | 17 |
| α-helix | 168-170 | 3 | |
| α-helix | 171-173 | 3 | |
| α-helix | 174-185 | 12 | |
| β-strand | 190-195 | 6 | 17 |
| α-helix | 201-209 | 9 | |
| β-strand | 214-216 | 3 | 17 |
| α-helix | 223-230 | 8 | |
| α-helix | 235-240 | 6 | |
| β-strand | 241 | 1 | 18 |
| α-helix | 244-246 | 3 | |
| β-strand | 253-254 | 2 | 19 |
| β-strand | 261-262 | 2 | 19 |
| β-strand | 264 | 1 | 20 |
| β-strand | 266-268 | 3 | 21 |
| β-strand | 274-275 | 2 | 21 |
Chain F: 3 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 5 | 1 | 10 |
| β-strand | 8-11 | 4 | 11 |
| α-helix | 14-24 | 11 | |
| β-strand | 34-37 | 4 | 11 |
| β-strand | 42-45 | 4 | 11 |
| α-helix | 48-50 | 3 | |
| α-helix | 54-63 | 10 | |
Chain G: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 138-140 | 3 | 27 |
| α-helix | 141-147 | 7 | |
| α-helix | 161-162 | 2 | |
| β-strand | 165-168 | 4 | 27 |
| β-strand | 177-182 | 6 | 27 |
| α-helix | 183-193 | 11 | |
| α-helix | 198-235 | 38 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| DNA1 | J | DNA | 49 | Homo sapiens | |
| DNA2 | K | DNA | 49 | Homo sapiens | |
| General transcription and DNA repair factor IIH helicase subunit XPB | A | protein | 782 | Homo sapiens | P19447 (AlphaFold model) |
| General transcription factor IIH subunit 5 | F | protein | 71 | Homo sapiens | Q6ZYL4 (AlphaFold model) |
| TFIIH basal transcription factor complex helicase XPD subunit | B | protein | 760 | Homo sapiens | P18074 (AlphaFold model) |
| General transcription factor IIH subunit 3 | E | protein | 308 | Homo sapiens | Q13889 (AlphaFold model) |
| General transcription factor IIH subunit 2 | D | protein | 395 | Homo sapiens | Q13888 |
| General transcription factor IIH subunit 4 | C | protein | 462 | Homo sapiens | Q92759 |
| DNA repair protein complementing XP-A cells | G | protein | 273 | Homo sapiens | P23025 |
Sequence of entity 1 (J), FASTA
>6RO4_1 DNA1 (chains J)
CAAAGTCACGACCTAGACACTGCGAGCTCGAATTCACTGGAGTGACCTC
Sequence of entity 2 (K), FASTA
>6RO4_2 DNA2 (chains K)
GAGGTCACTCCAGTGAATTCGAGCTCGCAACAATGAGCACATACCTAGT
Sequence of entity 3 (A), FASTA
>6RO4_3 General transcription and DNA repair factor IIH helicase subunit XPB (chains A)
MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTKVDEYGAKD
YRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTA
YSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESC
HPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQG
KSDIPMDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRND
SVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKR
CLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRS
WEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDL
NFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNK
FRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNP
KINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFY
SLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAAT
DLDAEEEVVAGEFGSRSSQASRRFGTMSSMSGADDTVYMEYHSSRSKAPSKHVHPLFKRF
RK
Sequence of entity 4 (F), FASTA
>6RO4_4 General transcription factor IIH subunit 5 (chains F)
MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGEL
MDQNAFSLTQK
Sequence of entity 5 (B), FASTA
>6RO4_5 TFIIH basal transcription factor complex helicase XPD subunit (chains B)
MKLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQ
RAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPE
VTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDL
KALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNID
NVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARE
TDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSG
LAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGFTIIIEP
FDDRTPTIANPILHFSCMDASLAIKPVFERFQSVIITSGTLSPLDIYPKILDFHPVTMAT
FTMTLARVCLCPMIIGRGNDQVAISSKFETREDIAVIRNYGNLLLEMSAVVPDGIVAFFT
SYQYMESTVASWYEQGILENIQRNKLLFIETQDGAETSVALEKYQEACENGRGAILLSVA
RGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFDAMRHA
AQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEHLTDANLNLTVDEGVQVAKYF
LRQMAQPFHREDQLGLSLLSLEQLESEETLKRIEQIAQQL
Sequence of entity 6 (E), FASTA
>6RO4_6 General transcription factor IIH subunit 3 (chains E)
MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVI
ASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMT
KSDIKGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNV
IFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQ
LILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAK
KKKLKVSA
Sequence of entity 7 (D), FASTA
>6RO4_7 General transcription factor IIH subunit 2 (chains D)
MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRH
LYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTEL
SGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPS
NIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPP
ASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCE
LPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVC
AVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV
Sequence of entity 8 (C), FASTA
>6RO4_8 General transcription factor IIH subunit 4 (chains C)
MESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRML
FLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRI
ALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVLHFMVGSPSAAVSQDLAQLLS
QAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQL
SFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVSGAGGT
VHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGIT
AQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFEL
LLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS
Sequence of entity 9 (G), FASTA
>6RO4_9 DNA repair protein complementing XP-A cells (chains G)
MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMA
NVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNH
FDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKL
YLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETI
VHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| SF4 | Iron/sulfur cluster | Fe4 S4 | 1 |
| ZN | Zinc ion | Zn | 6 |
Primary citation
Structural basis of TFIIH activation for nucleotide excision repair. Kokic, G., Chernev, A., Tegunov, D. et al. Nat Commun (2019) 10:2885-2885. DOI 10.1038/s41467-019-10745-5 · PubMed
Other PDB entries of the same protein (UniProt P19447 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 4ERN 1.8 Å, Crystal structure of the C-terminal domain of human XPB/ERCC-3 excision repair protein…
- 7NVV 2.9 Å, XPB-containing part of TFIIH in a post-translocated state (with ADP-BeF3)
- 28JM 3.29 Å, Cryo-EM structure of the human holo-TFIIH and XPC initial encounter complex
- 7EGB 3.3 Å, TFIID-based holo PIC on SCP promoter
- 8EBU 3.3 Å, XPC release from Core7-XPA-DNA (Cy5)
- 9PD3 3.3 Å, NER dual incision complex - DuIS
- 28JS 3.32 Å, Cryo-EM structure of the human holo-TFIIH-XPC complex bound to bulky lesion-mimic DNA…
- 9PD4 3.4 Å, NER dual incision complex - DuIM
- 7AD8 3.5 Å, Core TFIIH-XPA-DNA complex with modelled p62 subunit
- 9XYU 3.5 Å, NER complex - C7CAD.ATP
- 28KE 3.6 Å, Cryo-EM structure of the human holo-TFIIH-XPC-XPA complex bound to bulky lesion-mimic DNA
- 8EBX 3.6 Å, XPA repositioning Core7 of TFIIH relative to XPC-DNA lesion (AP)
Browse structure collections
About this viewer
MolViewer shows 6RO4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.