Catalytic antibody D2.3 complex. Determined by X-ray diffraction at 1.9 Å resolution. Released 13 Jan 1999.
Explore 1YEI in 3D Show helices and sheets RCSB PDB PDBe
1YEI contains 14 α-helices and 47 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-6 | 4 | 7 |
| α-helix | 7-9 | 3 | |
| β-strand | 10-12 | 3 | 8 |
| β-strand | 18-25 | 8 | 7 |
| α-helix | 29-31 | 3 | |
| β-strand | 34-40 | 7 | 8 |
| β-strand | 44-52 | 9 | 8 |
| β-strand | 56-59 | 4 | 8 |
| α-helix | 61-63 | 3 | |
| β-strand | 64 | 1 | 7 |
| β-strand | 67-72 | 6 | 7 |
| β-strand | 77-82 | 6 | 7 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-94 | 7 | 8 |
| β-strand | 97-98 | 2 | 9 |
| β-strand | 100C-100D | 2 | 9 |
| β-strand | 102-103 | 2 | 8 |
| β-strand | 107-111 | 5 | 8 |
| α-helix | 114-116 | 3 | |
| β-strand | 117 | 1 | 10 |
| β-strand | 120-124 | 5 | 11 |
| β-strand | 135-145 | 11 | 11 |
| β-strand | 146 | 1 | 10 |
| β-strand | 151-155 | 4 | 12 |
| α-helix | 160-162 | 3 | |
| β-strand | 169-171 | 3 | 11 |
| α-helix | 172-174 | 3 | |
| β-strand | 175-177 | 3 | 11 |
| β-strand | 182-192 | 11 | 11 |
| β-strand | 204-210 | 6 | 12 |
| α-helix | 211-213 | 3 | |
| β-strand | 215-220 | 6 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 10-13 | 4 | 2 |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 27C | 1 | 3 |
| β-strand | 31 | 1 | 3 |
| β-strand | 33-38 | 6 | 2 |
| β-strand | 44-49 | 6 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 70-75 | 6 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 2 |
| α-helix | 96 | 1 | |
| β-strand | 97-98 | 2 | 2 |
| β-strand | 102-106 | 5 | 2 |
| β-strand | 111 | 1 | 4 |
| β-strand | 114-118 | 5 | 5 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-126 | 5 | |
| β-strand | 129-139 | 11 | 5 |
| β-strand | 140 | 1 | 4 |
| β-strand | 144-150 | 7 | 6 |
| β-strand | 153-155 | 3 | 6 |
| β-strand | 159-163 | 5 | 5 |
| β-strand | 173-182 | 10 | 5 |
| α-helix | 183-186 | 4 | |
| β-strand | 191-198 | 8 | 6 |
| β-strand | 205-210 | 6 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (ig antibody D2.3 (light chain)) | L | protein | 219 | Mus musculus | Q58EU8 (AlphaFold model) |
| Protein (ig antibody D2.3 (heavy chain)) | H | protein | 222 | Mus musculus | P01863 (AlphaFold model) |
>1YEI_1 PROTEIN (IG ANTIBODY D2.3 (LIGHT CHAIN)) (chains L) DIVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIHLVSKLD SGVPDRITGSGSGTDFTLKISRVEAADLGVYYCVQGTHFPYTFGGGTKLEILRADAAPTV SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>1YEI_2 PROTEIN (IG ANTIBODY D2.3 (HEAVY CHAIN)) (chains H) EMQLQQSGAELLRPGTSVKLSCKTSGYIFTSYWIHWVKQRSGQGLEWIARIYPGTGSTYY NEKFKGKATLTADKSSSTAYMQLSTLKSEDSAVYFCTRWGFIPVREDYVMDYWGQGTLVT VSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVL QSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Crossreactivity, efficiency and catalytic specificity of an esterase-like antibody. Gigant, B., Charbonnier, J.B., Eshhar, Z. et al. J Mol Biol (1998) 284:741-750. DOI 10.1006/jmbi.1998.2198 · PubMed
Other PDB entries of the same protein (UniProt Q58EU8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1YEI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.