High resolution S. cerevisiae Bub3 mitotic checkpoint protein. Determined by X-ray diffraction at 1.1 Å resolution. Released 11 Jan 2005.
Explore 1YFQ in 3D Show helices and sheets RCSB PDB PDBe
1YFQ contains 9 α-helices and 30 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-5 | 4 | 1 |
| β-strand | 14-20 | 7 | 2 |
| α-helix | 21-23 | 3 | |
| β-strand | 25-30 | 6 | 2 |
| β-strand | 34-41 | 8 | 2 |
| β-strand | 46-54 | 9 | 2 |
| β-strand | 59-66 | 8 | 3 |
| β-strand | 70-76 | 7 | 3 |
| β-strand | 81-84 | 4 | 3 |
| β-strand | 92-94 | 3 | 3 |
| α-helix | 95 | 1 | |
| β-strand | 96 | 1 | 4 |
| β-strand | 104-110 | 7 | 5 |
| β-strand | 114-119 | 6 | 5 |
| β-strand | 123-127 | 5 | 5 |
| α-helix | 129-132 | 4 | |
| β-strand | 135 | 1 | 4 |
| β-strand | 137-141 | 5 | 5 |
| β-strand | 153-158 | 6 | 6 |
| β-strand | 162-167 | 6 | 6 |
| β-strand | 171-176 | 6 | 6 |
| β-strand | 186-189 | 4 | 6 |
| β-strand | 196-201 | 6 | 7 |
| α-helix | 202 | 1 | |
| α-helix | 204-206 | 3 | |
| β-strand | 208-213 | 6 | 7 |
| β-strand | 217-222 | 6 | 7 |
| β-strand | 236-239 | 4 | 7 |
| β-strand | 254-259 | 6 | 8 |
| α-helix | 265 | 1 | |
| β-strand | 266-270 | 5 | 8 |
| β-strand | 275-279 | 5 | 8 |
| β-strand | 284-288 | 5 | 8 |
| α-helix | 289-291 | 3 | |
| β-strand | 296-302 | 7 | 1 |
| β-strand | 306-312 | 7 | 1 |
| α-helix | 315-318 | 4 | |
| α-helix | 329-331 | 3 | |
| β-strand | 332-337 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cell cycle arrest protein BUB3 | A | protein | 342 | Saccharomyces cerevisiae | P26449 (AlphaFold model) |
>1YFQ_1 Cell cycle arrest protein BUB3 (chains A) MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLL CCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASW DGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLC EDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRFAFRC HRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKI ACSDNILCLATSDDTFKTNAAIDQTIELNASSIYIIFDYENP
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 4 |
Water and common crystallization additives (ACT) are not listed.
The 1.1-a structure of the spindle checkpoint protein bub3p reveals functional regions. Wilson, D.K., Cerna, D., Chew, E. J Biol Chem (2005) 280:13944-13951. DOI 10.1074/jbc.M412919200 · PubMed
Other PDB entries of the same protein (UniProt P26449 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1YFQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.