5FMV: Human CD45 extracellular region, domains d1-d4

Crystal structure of human CD45 extracellular region, domains d1-d4. Determined by X-ray diffraction at 2.9 Å resolution. Released 23 Mar 2016.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 5,811
Mol. weight: 86.21 kDa
Ligands: NAG
Released: 23 Mar 2016

Explore 5FMV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5FMV contains 25 α-helices and 62 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	225	1	1
α-helix	226-229	4
β-strand	235-240	6	2
β-strand	245-250	6	2
β-strand	257-258	2	3
β-strand	267-271	5	2
α-helix	272	1
β-strand	276-282	7	3
β-strand	287	1	1
α-helix	290	1
β-strand	291-296	6	3
α-helix	301-303	3
β-strand	304-308	5	4
α-helix	312-314	3
β-strand	319-325	7	4
α-helix	333-335	3
β-strand	336-342	7	5
β-strand	345-348	4	5
β-strand	351-354	4	4
α-helix	357-358	2
β-strand	362-371	10	5
β-strand	374-384	11	5
β-strand	394-399	6	6
β-strand	406-411	6	6
β-strand	419-425	7	7
β-strand	429-436	8	7
β-strand	441-444	4	6
α-helix	447-448	2
β-strand	452-462	11	7
β-strand	466-468	3	7
β-strand	472-477	6	7
α-helix	478-480	3
α-helix	482-486	5
β-strand	487-493	7	8
β-strand	499-504	6	8
β-strand	516-522	7	9
β-strand	526-532	7	9
β-strand	536-539	4	8
α-helix	542-543	2
β-strand	547-554	8	9
β-strand	555	1	10
β-strand	560	1	10
α-helix	561-563	3
β-strand	564-569	6	9

Chain B: 13 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	235-240	6	11
β-strand	245-250	6	11
β-strand	257-258	2	12
α-helix	264-266	3
β-strand	267-271	5	11
α-helix	272	1
β-strand	276-282	7	12
α-helix	287	1
α-helix	290	1
β-strand	291-296	6	12
α-helix	301-303	3
β-strand	304-308	5	13
α-helix	312-314	3
β-strand	319-325	7	13
α-helix	333-335	3
β-strand	336-342	7	14
β-strand	345-348	4	14
β-strand	351-354	4	13
α-helix	357-358	2
β-strand	362-371	10	14
β-strand	374-384	11	14
β-strand	394-399	6	15
β-strand	406-411	6	15
β-strand	419-425	7	7
β-strand	430-436	7	7
β-strand	441-444	4	15
α-helix	447-448	2
β-strand	452-462	11	7
β-strand	466-468	3	7
β-strand	472-477	6	7
α-helix	478-480	3
α-helix	482-486	5
β-strand	487-493	7	16
β-strand	499-504	6	16
β-strand	516-522	7	17
β-strand	526-532	7	17
β-strand	536-539	4	16
α-helix	542-543	2
β-strand	547-554	8	17
β-strand	555	1	18
β-strand	560	1	18
α-helix	561-563	3
β-strand	564-569	6	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Receptor-type tyrosine-protein phosphatase C	A, B	protein	361	HOMO SAPIENS	P08575 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5FMV_1 RECEPTOR-TYPE TYROSINE-PROTEIN PHOSPHATASE C (chains A, B)
ETGKPTCDEKYANITVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASV
SISHNSCTAPDKTLILDVPPGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYR
FQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCR
SEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHA
YIIAKVQRNGSAAMCHFTTKSAPPSQVWNMTVSMTSDNSMHVKCRPPRDRNGPHERYHLE
VEAGNTLVRNESHKNCDFRVKDLQYSTDYTFKAYFHNGDYPGEPFILHHSTSGTKHHHHH
H

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	11

Water and common crystallization additives (SO4) are not listed.

Primary citation

Initiation of T Cell Signaling by Cd45 Segregation at 'Close Contacts'. Chang, V.T., Fernandes, R.A., Ganzinger, K.A. et al. Nat Immunol (2016) 17:574. DOI 10.1038/NI.3392 · PubMed

Other PDB entries of the same protein (UniProt P08575 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5FN7 2.3 Å, Crystal structure of human CD45 extracellular region, domains d1-d2
1YGR 2.9 Å, Crystal structure of the tandem phosphatase domain of RPTP CD45
1YGU 2.9 Å, Crystal structure of the tandem phosphatase domains of RPTP CD45 with a pTyr peptide
5FN6 3.3 Å, Crystal structure of human CD45 extracellular region, domains d1-d3
8VSE 3.8 Å, Cryo-EM structure of human CD45 extracellular region in complex with adenoviral protein…

Browse structure collections

About this viewer

MolViewer shows 5FMV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.