5FN7: Human CD45 extracellular region, domains d1-d2

Crystal structure of human CD45 extracellular region, domains d1-d2. Determined by X-ray diffraction at 2.3 Å resolution. Released 23 Mar 2016.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 2,977
Mol. weight: 44.99 kDa
Ligands: NAG, HG
Released: 23 Mar 2016

Explore 5FN7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5FN7 contains 18 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
β-strand	10	1	1
α-helix	11-14	4
β-strand	20-25	6	2
β-strand	30-35	6	2
β-strand	42-44	3	3
α-helix	49-51	3
β-strand	52-56	5	2
α-helix	57	1
β-strand	61-67	7	3
β-strand	72	1	1
α-helix	75	1
β-strand	76-81	6	3
α-helix	86-88	3
β-strand	89-93	5	4
α-helix	97-99	3
β-strand	104-110	7	4
α-helix	118-120	3
β-strand	121-127	7	5
β-strand	130-133	4	5
β-strand	136-139	4	4
β-strand	142	1	6
α-helix	143	1
β-strand	147-156	10	5
β-strand	159-169	11	5

Chain B: 9 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	10	1	7
α-helix	11-14	4
β-strand	20-25	6	8
β-strand	30-35	6	8
β-strand	42-44	3	9
α-helix	49-51	3
β-strand	52-56	5	8
α-helix	57	1
β-strand	61-67	7	9
β-strand	72	1	7
α-helix	75	1
β-strand	76-81	6	9
α-helix	86-88	3
β-strand	89-93	5	10
α-helix	97-99	3
β-strand	104-110	7	10
α-helix	118-120	3
β-strand	121-127	7	6
β-strand	130-133	4	6
β-strand	136-139	4	10
β-strand	142	1	5
α-helix	143	1
β-strand	147-156	10	6
β-strand	159-169	11	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Receptor-type tyrosine-protein phosphatase C	A, B	protein	186	HOMO SAPIENS	P08575 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5FN7_1 RECEPTOR-TYPE TYROSINE-PROTEIN PHOSPHATASE C (chains A, B)
ETGIEGRKPTCDEKYANITVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECK
NASVSISHNSCTAPDKTLILDVPPGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQN
ITYRFQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEGTK
HHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	9
HG	Mercury (II) ion	Hg	2

Primary citation

Initiation of T Cell Signaling by Cd45 Segregation at 'Close Contacts'. Chang, V.T., Fernandes, R.A., Ganzinger, K.A. et al. Nat Immunol (2016) 17:574. DOI 10.1038/NI.3392 · PubMed

Other PDB entries of the same protein (UniProt P08575 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1YGR 2.9 Å, Crystal structure of the tandem phosphatase domain of RPTP CD45
1YGU 2.9 Å, Crystal structure of the tandem phosphatase domains of RPTP CD45 with a pTyr peptide
5FMV 2.9 Å, Crystal structure of human CD45 extracellular region, domains d1-d4
5FN6 3.3 Å, Crystal structure of human CD45 extracellular region, domains d1-d3
8VSE 3.8 Å, Cryo-EM structure of human CD45 extracellular region in complex with adenoviral protein…

Browse structure collections

About this viewer

MolViewer shows 5FN7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.