1YGS: SMAD4 tumor suppressor C-terminal domain

Name: PDB 1YGS: Crystal structure of the SMAD4 tumor suppressor C-terminal domain
Published: 1998-07-08
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: tumour suppressor

Crystal structure of the SMAD4 tumor suppressor C-terminal domain. Determined by X-ray diffraction at 2.1 Å resolution. Released 8 Jul 1998.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,658
Mol. weight: 25.51 kDa
Released: 8 Jul 1998

Explore 1YGS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1YGS contains 7 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	322-330	9	1
β-strand	333-342	10	1
β-strand	347-351	5	2
β-strand	361-363	3	2
α-helix	374-380	7
β-strand	387-392	6	2
β-strand	396-401	6	2
β-strand	407-410	4	1
α-helix	412-416	5
α-helix	420-421	2
β-strand	427-429	3	1
β-strand	434-438	5	2
α-helix	440-454	15
α-helix	493-497	5
β-strand	500-504	5	1
α-helix	518-520	3
β-strand	524-529	6	1
α-helix	530-541	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SMAD4	A	protein	234	Homo sapiens	Q13485 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1YGS_1 SMAD4 (chains A)
APEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIER
ARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVF
DLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRL
CILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD

Primary citation

A structural basis for mutational inactivation of the tumour suppressor Smad4. Shi, Y., Hata, A., Lo, R.S. et al. Nature (1997) 388:87-93. DOI 10.1038/40431 · PubMed

Other PDB entries of the same protein (UniProt Q13485 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YIC 1.6 Å, 14-3-3 sigma in complex with SMAD4 pS403 peptide
9HWE 1.7 Å, SMAD4 MH2, residues 314-552
9HZA 2.03 Å, SMAD4 MH2, residues 272-552
5MEY 2.05 Å, Crystal structure of Smad4-MH1 bound to the GGCGC site.
9QE6 2.1 Å, SMAD4 MH2 domain (residues 314-552) bound by Nanobody A1 (NbA1)
5UWU 2.24 Å, Crystal Structure of SMAD4 NES Peptide in complex with CRM1-Ran-RanBP1
1U7F 2.6 Å, Crystal Structure of the phosphorylated Smad3/Smad4 heterotrimeric complex
5C4V 2.6 Å, Ski-like protein
1DD1 2.62 Å, Crystal structure analysis of the SMAD4 active fragment
1U7V 2.7 Å, Crystal Structure of the phosphorylated Smad2/Smad4 heterotrimeric complex
1MR1 2.85 Å, Crystal Structure of a Smad4-Ski Complex
5MEZ 2.98 Å, Crystal structure of Smad4-MH1 bound to the GGCT site.

Browse structure collections

About this viewer

MolViewer shows 1YGS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.