1U7V: Mothers against decapentaplegic homolog 2

Crystal Structure of the phosphorylated Smad2/Smad4 heterotrimeric complex. Determined by X-ray diffraction at 2.7 Å resolution. Released 28 Sept 2004.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,777
Mol. weight: 70.73 kDa
Released: 28 Sept 2004

Explore 1U7V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1U7V contains 26 α-helices and 38 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	275-281	7	1
β-strand	284-285	2	1
β-strand	290-292	3	1
β-strand	296-300	5	2
β-strand	307	1	2
β-strand	310-312	3	2
α-helix	323-328	6
β-strand	336-341	6	2
β-strand	344-349	6	2
β-strand	355-358	4	1
α-helix	360-365	6
β-strand	374-376	3	1
β-strand	381-386	6	2
α-helix	387-395	9
α-helix	402-406	5
α-helix	407-412	6
β-strand	413-418	6	1
α-helix	431-433	3
β-strand	437-442	6	1
α-helix	443-453	11

Chain B: 11 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	322-329	8	5
β-strand	334	1	5
α-helix	337-338	2
β-strand	339-342	4	5
β-strand	347-350	4	6
β-strand	361	1	6
α-helix	364-366	3
α-helix	374-380	7
β-strand	387-391	5	6
β-strand	397-400	4	6
β-strand	407-410	4	5
α-helix	412-417	6
α-helix	420-421	2
β-strand	427-429	3	5
α-helix	430	1
β-strand	434-438	5	6
α-helix	440-459	20
α-helix	492-495	4
α-helix	496-499	4
β-strand	500-505	6	5
α-helix	518-520	3
β-strand	524-528	5	5
α-helix	530-540	11

Chain C: 8 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	276-281	6	3
β-strand	284-285	2	3
α-helix	288-289	2
β-strand	290-291	2	3
β-strand	296-300	5	4
β-strand	307	1	4
β-strand	310-312	3	4
α-helix	323-329	7
β-strand	336-341	6	4
β-strand	344-349	6	4
β-strand	355-358	4	3
α-helix	360-366	7
β-strand	374-376	3	3
β-strand	381-386	6	4
α-helix	387-397	11
α-helix	402-406	5
α-helix	407-412	6
β-strand	413-418	6	3
α-helix	431-433	3
β-strand	437-441	5	3
α-helix	443-453	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mothers against decapentaplegic homolog 2	A, C	protein	198	Homo sapiens	Q15796 (AlphaFold model)
Mothers against decapentaplegic homolog 4	B	protein	236	Homo sapiens	Q13485 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1U7V_1 Mothers against decapentaplegic homolog 2 (chains A, C)
EPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTR
RHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQE
FAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWL
DKVLTQMGSPSVRCSSMS

Sequence of entity 2 (B), FASTA

>1U7V_2 Mothers against decapentaplegic homolog 4 (chains B)
ISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRT
EAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSA
YIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVD
DLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQ

Primary citation

Structural basis of heteromeric smad protein assembly in tgf-Beta signaling. Chacko, B.M., Qin, B.Y., Tiwari, A. et al. Mol Cell (2004) 15:813-823. DOI 10.1016/j.molcel.2004.07.016 · PubMed

Other PDB entries of the same protein (UniProt Q15796 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YIA 1.3 Å, 14-3-3 sigma in complex with SMAD2 pS465 peptide
6M64 1.45 Å, Crystal structure of SMAD2 in complex with CBP
1KHX 1.8 Å, Crystal structure of a phosphorylated Smad2
5XOD 1.85 Å, Crystal structure of human Smad2-Ski complex
6ZVQ 2.03 Å, Complex between SMAD2 MH2 domain and peptide from Ski corepressor
1DEV 2.2 Å, Crystal structure of SMAD2 MH2 domain bound to the smad-binding domain of sara
5ZOJ 2.79 Å, Crystal structure of human SMAD2-MAN1 complex
7CO1 3.3 Å, Crystal structure of SMAD2 in complex with wild-type CBP
2LB3 Structure of the WW domain of PIN1 in complex with a human phosphorylated Smad3 derived…

Browse structure collections

About this viewer

MolViewer shows 1U7V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.