9HWE: SMAD4 MH2, residues 314-552

SMAD4 MH2, residues 314-552. Determined by X-ray diffraction at 1.7 Å resolution. Released 15 Jul 2026.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,712
Mol. weight: 26.5 kDa
Released: 15 Jul 2026

Explore 9HWE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9HWE contains 7 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	322-330	9	1
β-strand	333-342	10	1
β-strand	347-351	5	2
β-strand	361-363	3	2
α-helix	374-380	7
β-strand	387-392	6	2
β-strand	396-401	6	2
β-strand	407-410	4	1
α-helix	412-417	6
α-helix	420-421	2
β-strand	427-429	3	1
β-strand	434-438	5	2
α-helix	440-456	17
α-helix	492-497	6
β-strand	500-504	5	1
α-helix	518-520	3
β-strand	524-529	6	1
α-helix	530-542	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mothers against decapentaplegic homolog 4	A	protein	240	Homo sapiens	Q13485 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9HWE_1 Mothers against decapentaplegic homolog 4 (chains A)
GISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHR
TEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPS
AYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGV
DDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD

Primary citation

(RUNNING TITLE:) Insights into the structure-activity relationship of SMAD4 variants linked to Myhre syndrome and hereditary hemorrhagic telangiectasia. Torner, C., Condeminas, M., Pluta, R. et al. To be published.

Other PDB entries of the same protein (UniProt Q13485 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YIC 1.6 Å, 14-3-3 sigma in complex with SMAD4 pS403 peptide
9HZA 2.03 Å, SMAD4 MH2, residues 272-552
5MEY 2.05 Å, Crystal structure of Smad4-MH1 bound to the GGCGC site.
1YGS 2.1 Å, Crystal structure of the SMAD4 tumor suppressor C-terminal domain
9QE6 2.1 Å, SMAD4 MH2 domain (residues 314-552) bound by Nanobody A1 (NbA1)
5UWU 2.24 Å, Crystal Structure of SMAD4 NES Peptide in complex with CRM1-Ran-RanBP1
1U7F 2.6 Å, Crystal Structure of the phosphorylated Smad3/Smad4 heterotrimeric complex
5C4V 2.6 Å, Ski-like protein
1DD1 2.62 Å, Crystal structure analysis of the SMAD4 active fragment
1U7V 2.7 Å, Crystal Structure of the phosphorylated Smad2/Smad4 heterotrimeric complex
1MR1 2.85 Å, Crystal Structure of a Smad4-Ski Complex
5MEZ 2.98 Å, Crystal structure of Smad4-MH1 bound to the GGCT site.

Browse structure collections

About this viewer

MolViewer shows 9HWE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.