1YIB: Human EB1 C-terminal Dimerization Domain

Crystal Structure of the Human EB1 C-terminal Dimerization Domain. Determined by X-ray diffraction at 1.8 Å resolution. Released 8 Mar 2005.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 541
Mol. weight: 8.49 kDa
Released: 8 Mar 2005

Explore 1YIB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1YIB contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	191-230	40
α-helix	232-234	3
α-helix	237-246	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Microtubule-associated protein RP/EB family member 1	A	protein	76	Homo sapiens	Q15691 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1YIB_1 Microtubule-associated protein RP/EB family member 1 (chains A)
GPLGSGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVL
QRIVDILYATDEGFVI

Primary citation

Structural determinants for EB1-mediated recruitment of APC and spectraplakins to the microtubule plus end. Slep, K.C., Rogers, S.L., Elliott, S.L. et al. J Cell Biol (2005) 168:587-598. DOI 10.1083/jcb.200410114 · PubMed

Other PDB entries of the same protein (UniProt Q15691 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QJZ 1.25 Å, Structural Basis of Microtubule Plus End Tracking by XMAP215, CLIP-170 and EB1
2R8U 1.35 Å, Structure of fragment of human end-binding protein 1 (EB1) containing the N-terminal…
1PA7 1.45 Å, Crystal structure of amino-terminal microtubule binding domain of EB1
1WU9 1.54 Å, Crystal structure of the C-terminal domain of the end-binding protein 1 (EB1)
5JVM 1.57 Å, The neck-linker and alpha 7 helix of Mus musculus KIF3C
1VKA 1.6 Å, Southeast Collaboratory for Structural Genomics: Hypothetical Human Protein Q15691…
5JX1 1.67 Å, The neck-linker and alpha 7 helix of Mus musculus KIF3A fused to EB1
1TXQ 1.8 Å, Crystal structure of the EB1 C-terminal domain complexed with the CAP-Gly domain of…
6YF5 1.83 Å, Lamin A 17-70 coil1A dimer stabilized by C-terminal capping
2HKQ 1.86 Å, Crystal structure of the C-terminal domain of human EB1 in complex with the CAP-Gly…
2HL5 1.93 Å, Crystal structure of the C-terminal domain of human EB1 in complex with the A49M mutant…
5JVU 1.95 Å, The neck-linker and alpha 7 helix of Drosophila melanogaster kinesin-1 fused to EB1

Browse structure collections

About this viewer

MolViewer shows 1YIB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.