1YIG: Human EB1 C-terminal Dimerization Domain

Crystal Structure of the Human EB1 C-terminal Dimerization Domain. Determined by X-ray diffraction at 2.0 Å resolution. Released 8 Mar 2005.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,071
Mol. weight: 17.23 kDa
Released: 8 Mar 2005

Explore 1YIG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1YIG contains 7 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	191-230	40
α-helix	232-234	3
α-helix	237-247	11
α-helix	251-253	3

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	191-230	40
α-helix	232-234	3
α-helix	237-246	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Microtubule-associated protein RP/EB family member 1	A, B	protein	76	Homo sapiens	Q15691 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1YIG_1 Microtubule-associated protein RP/EB family member 1 (chains A, B)
GPLGSGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVL
QRIMDILYATDEGFVI

Primary citation

Structural determinants for EB1-mediated recruitment of APC and spectraplakins to the microtubule plus end. Slep, K.C., Rogers, S.L., Elliott, S.L. et al. J Cell Biol (2005) 168:587-598. DOI 10.1083/jcb.200410114 · PubMed

Other PDB entries of the same protein (UniProt Q15691 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QJZ 1.25 Å, Structural Basis of Microtubule Plus End Tracking by XMAP215, CLIP-170 and EB1
2R8U 1.35 Å, Structure of fragment of human end-binding protein 1 (EB1) containing the N-terminal…
1PA7 1.45 Å, Crystal structure of amino-terminal microtubule binding domain of EB1
1WU9 1.54 Å, Crystal structure of the C-terminal domain of the end-binding protein 1 (EB1)
5JVM 1.57 Å, The neck-linker and alpha 7 helix of Mus musculus KIF3C
1VKA 1.6 Å, Southeast Collaboratory for Structural Genomics: Hypothetical Human Protein Q15691…
5JX1 1.67 Å, The neck-linker and alpha 7 helix of Mus musculus KIF3A fused to EB1
1TXQ 1.8 Å, Crystal structure of the EB1 C-terminal domain complexed with the CAP-Gly domain of…
1YIB 1.8 Å, Crystal Structure of the Human EB1 C-terminal Dimerization Domain
6YF5 1.83 Å, Lamin A 17-70 coil1A dimer stabilized by C-terminal capping
2HKQ 1.86 Å, Crystal structure of the C-terminal domain of human EB1 in complex with the CAP-Gly…
2HL5 1.93 Å, Crystal structure of the C-terminal domain of human EB1 in complex with the A49M mutant…

Browse structure collections

About this viewer

MolViewer shows 1YIG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.