Crystal Structures of EAP Domains from Staphylococcus aureus Reveal an Unexpected Homology to Bacterial Superantigens. Determined by X-ray diffraction at 1.8 Å resolution. Released 1 Mar 2005.
Explore 1YN4 in 3D Show helices and sheets RCSB PDB PDBe
1YN4 contains 4 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 44-53 | 10 | 1 |
| β-strand | 56-57 | 2 | 1 |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 72-73 | 2 | 2 |
| α-helix | 74-89 | 16 | |
| α-helix | 93-97 | 5 | |
| β-strand | 102-108 | 7 | 1 |
| β-strand | 113-117 | 5 | 1 |
| α-helix | 122-124 | 3 | |
| β-strand | 127-128 | 2 | 2 |
| α-helix | 130-132 | 3 | |
| β-strand | 133-140 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| EapH1 | A | protein | 99 | Staphylococcus aureus | A0A0H3K0M1 (AlphaFold model) |
>1YN4_1 EapH1 (chains A) GKHTVPYTISVDGITALHRTYFVFPENKKVLYQEIDSKVKNELASQRGVTTEKINNAQTA TYTLTLNDGNKKVVNLKKNDDAKNSIDPSTIKQIQIVVK
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
The Crystal Structures of EAP Domains from Staphylococcus aureus Reveal an Unexpected Homology to Bacterial Superantigens. Geisbrecht, B.V., Hamaoka, B.Y., Perman, B. et al. J Biol Chem (2005) 280:17243-17250. DOI 10.1074/jbc.M412311200 · PubMed
Other PDB entries of the same protein (UniProt A0A0H3K0M1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1YN4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.