1YTB: Yeast tbp/tata-box complex

Crystal structure of a yeast tbp/tata-box complex. Determined by X-ray diffraction at 1.8 Å resolution. Released 26 Jan 1995.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Saccharomyces cerevisiae
Chains: 4
Atoms: 4,539
Mol. weight: 58.22 kDa
Released: 26 Jan 1995

Explore 1YTB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1YTB contains 10 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	65	1
β-strand	66-75	10	1
α-helix	82-88	7
β-strand	92-93	2	1
β-strand	102-106	5	1
β-strand	111-115	5	1
β-strand	120-126	7	1
α-helix	129-146	18
β-strand	153-165	13	1
β-strand	170	1	2
α-helix	172-178	7
β-strand	183-184	2	1
β-strand	193-196	4	1
β-strand	203-206	4	1
β-strand	211-217	7	1
α-helix	220-236	17
β-strand	238	1	2

Chain B: 5 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	65	1
β-strand	66-75	10	3
α-helix	82-88	7
β-strand	92-93	2	3
β-strand	102-107	6	3
β-strand	110-115	6	3
β-strand	120-126	7	3
α-helix	129-146	18
β-strand	153-165	13	3
β-strand	170	1	4
α-helix	172-178	7
β-strand	183-184	2	3
β-strand	193-197	5	3
β-strand	202-206	5	3
β-strand	211-217	7	3
α-helix	220-236	17
β-strand	238	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (29MER)	C, D	DNA	29
Protein (tata binding protein (tbp))	A, B	protein	180	Saccharomyces cerevisiae	P13393 (AlphaFold model)

Sequence of entity 1 (C, D), FASTA

>1YTB_1 DNA (29MER) (chains C, D)
GTATATAAAACGGGTGGCGTTTTATATAC

Sequence of entity 2 (A, B), FASTA

>1YTB_2 PROTEIN (TATA BINDING PROTEIN (TBP)) (chains A, B)
SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGK
MVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHG
TFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM

Primary citation

Crystal structure of a yeast TBP/TATA-box complex. Kim, Y., Geiger, J.H., Hahn, S. et al. Nature (1993) 365:512-520. DOI 10.1038/365512a0 · PubMed

Other PDB entries of the same protein (UniProt P13393 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1NH2 1.9 Å, Crystal structure of a yeast TFIIA/TBP/DNA complex
4B0A 1.97 Å, The high-resolution structure of yTBP-yTAF1 identifies conserved and competing…
6E16 2.4 Å, Ternary structure of c-Myc-TBP-TAF1
1RM1 2.5 Å, Structure of a Yeast TFIIA/TBP/TATA-box DNA Complex
1YTF 2.5 Å, Yeast tfiia/tbp/dna complex
1TBP 2.6 Å, Crystal structure of yeast tata-binding protein and model for interaction with DNA
7Z0O 2.8 Å, Structure of transcription factor UAF in complex with TBP and 35S rRNA promoter DNA
7O4J 2.9 Å, Yeast RNA polymerase II transcription pre-initiation complex (consensus)
7OHA 2.9 Å, nucleosome with TBP and TFIIA bound at SHL +2
1NGM 2.95 Å, Crystal structure of a yeast Brf1-TBP-DNA ternary complex
7ML0 3.0 Å, RNA polymerase II pre-initiation complex (PIC1)
7OH9 3.0 Å, Nucleosome with TBP and TFIIA bound at SHL -6

Browse more

1YTB is part of these collections:

DNA and RNA

About this viewer

MolViewer shows 1YTB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.