Crystal Structure of the W64Y mutant of Villin Headpiece. Determined by X-ray diffraction at 1.5 Å resolution. Released 6 Sept 2005.
Explore 1YU7 in 3D Show helices and sheets RCSB PDB PDBe
1YU7 contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 18-23 | 6 | |
| α-helix | 26-28 | 3 | |
| α-helix | 38-41 | 4 | |
| α-helix | 44-51 | 8 | |
| α-helix | 55-59 | 5 | |
| α-helix | 63-72 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Villin | X | protein | 67 | Gallus gallus | P02640 (AlphaFold model) |
>1YU7_1 Villin (chains X) PTKLETFPLDVLVNTAAEDLPRGVDPSRKENHLSDEDFKAVFGMTRSAFANLPLYKQQNL KKEKGLF
High-resolution crystal structures of villin headpiece and mutants with reduced F-actin binding activity. Meng, J., Vardar, D., Wang, Y. et al. Biochemistry (2005) 44:11963-11973. DOI 10.1021/bi050850x · PubMed
Other PDB entries of the same protein (UniProt P02640 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1YU7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.