Structure and inter-domain interactions of domain II from the blood stage malarial protein, apical membrane antigen 1. Determined by solution NMR. Released 5 Jul 2005.
Explore 1YXE in 3D Show helices and sheets RCSB PDB PDBe
1YXE contains 9 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 315 | 1 | |
| α-helix | 326 | 1 | |
| β-strand | 327-329 | 3 | 1 |
| α-helix | 345-347 | 3 | |
| α-helix | 357-359 | 3 | |
| α-helix | 361-365 | 5 | |
| α-helix | 371-374 | 4 | |
| α-helix | 375-377 | 3 | |
| α-helix | 386-388 | 3 | |
| α-helix | 393-395 | 3 | |
| β-strand | 400-403 | 4 | 1 |
| β-strand | 408-411 | 4 | 1 |
| β-strand | 425 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| apical membrane antigen 1 | A | protein | 140 | Plasmodium falciparum | P22621 (AlphaFold model) |
>1YXE_1 apical membrane antigen 1 (chains A) MRGSHHHHHHGSNAKFGLWVDGNCEDIPHVNEFPAIDLFECNKLVFELSASDQPKQYEQH LTDYEKIKEGFKNKNASMIKSAFLPTGAFKADRYKSHGKGYNWGNYNTETQKCEIFNVKP TCLINNSSYIATTALSHPIE
Structure and Inter-domain Interactions of Domain II from the Blood-stage Malarial Protein, Apical Membrane Antigen 1. Feng, Z.P., Keizer, D.W., Stevenson, R.A. et al. J Mol Biol (2005) 350:641-656. DOI 10.1016/j.jmb.2005.05.011 · PubMed
Other PDB entries of the same protein (UniProt P22621 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1YXE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.