1YYH: Human Notch 1 ankyrin domain

Crystal structure of the human Notch 1 ankyrin domain. Determined by X-ray diffraction at 1.9 Å resolution. Released 16 Aug 2005.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,481
Mol. weight: 55.56 kDa
Released: 16 Aug 2005

Explore 1YYH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1YYH contains 24 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	60-66	7
α-helix	70-78	9
α-helix	93-100	8
α-helix	103-111	9
α-helix	127-134	8
α-helix	139-145	7
β-strand	153	1	1
β-strand	159	1	1
α-helix	160-167	8
α-helix	170-178	9
α-helix	193-200	8
α-helix	203-211	9
α-helix	226-232	7
α-helix	236-243	8

Chain B: 12 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	60-66	7
α-helix	70-78	9
α-helix	93-100	8
α-helix	103-111	9
α-helix	127-134	8
α-helix	139-145	7
β-strand	153	1	2
β-strand	159	1	2
α-helix	160-167	8
α-helix	170-178	9
α-helix	193-200	8
α-helix	203-211	9
α-helix	226-232	7
α-helix	236-242	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Notch 1, ankyrin domain	A, B	protein	253	Homo sapiens	P46531 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1YYH_1 Notch 1, ankyrin domain (chains A, B)
MDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGETA
LHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDAR
MHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNG
ANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVR
LLDLEHHHHHHHH

Primary citation

High-resolution crystal structure of the human Notch 1 ankyrin domain. Ehebauer, M.T., Chirgadze, D.Y., Hayward, P. et al. Biochem J (2005) 392:13-20. DOI 10.1042/BJ20050515 · PubMed

Other PDB entries of the same protein (UniProt P46531 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5L0R 1.5 Å, human POGLUT1 in complex with Notch1 EGF12 and UDP
9B3N 1.5 Å, Human Notch-1 EGFs 20-24
2F8Y 1.55 Å, Crystal structure of human Notch1 ankyrin repeats to 1.55A resolution.
9B3G 1.55 Å, Human Notch-1 EGFs 21-23
4D0E 1.61 Å, Human Notch1 EGF domains 11-13 mutant GlcNAc-fucose disaccharide modified at T466
4CUD 1.85 Å, Human Notch1 EGF domains 11-13 mutant fucosylated at T466
2HE0 1.9 Å, Crystal structure of a human Notch1 ankyrin domain mutant
3ETO 2.0 Å, 2 Angstrom Xray structure of the NOTCH1 Negative Regulatory Region (NRR)
5UB5 2.09 Å, human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP
3L95 2.19 Å, Crystal structure of the human Notch1 Negative Regulatory Region (NRR) bound to the fab…
4CUF 2.29 Å, Human Notch1 EGF domains 11-13 mutant T466S
5FMA 2.46 Å, human Notch 1, EGF 4-7

Browse structure collections

About this viewer

MolViewer shows 1YYH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.