4D0E: Neurogenic locus notch homolog protein 1

Human Notch1 EGF domains 11-13 mutant GlcNAc-fucose disaccharide modified at T466. Determined by X-ray diffraction at 1.61 Å resolution. Released 21 May 2014.

Method: X-ray diffraction
Resolution: 1.61 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,083
Mol. weight: 15.39 kDa
Ligands: CA
Released: 21 May 2014

Explore 4D0E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4D0E contains 7 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	415-417	3
α-helix	427	1
β-strand	428-432	5	1
β-strand	435-439	5	1
α-helix	440-441	2
β-strand	444-445	2	2
β-strand	451-452	2	2
α-helix	465	1
β-strand	466-470	5	3
β-strand	473-477	5	3
α-helix	478-479	2
β-strand	482-483	2	4
β-strand	489-490	2	4
α-helix	503	1
β-strand	504-507	4	5
β-strand	512-515	4	5
α-helix	516-517	2
β-strand	520-521	2	6
β-strand	527-528	2	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neurogenic locus notch homolog protein 1	A	protein	135	HOMO SAPIENS	P46531 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4D0E_1 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1 (chains A)
SAQDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCL
DQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQVD
LHHILDAQKMVWNHR

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Primary citation

Fringe-Mediated Extension of O-Linked Fucose in the Ligand-Binding Region of Notch1 Increases Binding to Mammalian Notch Ligands. Taylor, P., Takeuchi, H., Sheppard, D. et al. Proc Natl Acad Sci U S A (2014) 111:7290. DOI 10.1073/PNAS.1319683111 · PubMed

Other PDB entries of the same protein (UniProt P46531 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5L0R 1.5 Å, human POGLUT1 in complex with Notch1 EGF12 and UDP
9B3N 1.5 Å, Human Notch-1 EGFs 20-24
2F8Y 1.55 Å, Crystal structure of human Notch1 ankyrin repeats to 1.55A resolution.
9B3G 1.55 Å, Human Notch-1 EGFs 21-23
4CUD 1.85 Å, Human Notch1 EGF domains 11-13 mutant fucosylated at T466
2HE0 1.9 Å, Crystal structure of a human Notch1 ankyrin domain mutant
1YYH 1.9 Å, Crystal structure of the human Notch 1 ankyrin domain
3ETO 2.0 Å, 2 Angstrom Xray structure of the NOTCH1 Negative Regulatory Region (NRR)
5UB5 2.09 Å, human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP
3L95 2.19 Å, Crystal structure of the human Notch1 Negative Regulatory Region (NRR) bound to the fab…
4CUF 2.29 Å, Human Notch1 EGF domains 11-13 mutant T466S
5FMA 2.46 Å, human Notch 1, EGF 4-7

Browse structure collections

About this viewer

MolViewer shows 4D0E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.