9B3G: Human Notch-1 EGFs 21-23

Human Notch-1 EGFs 21-23. Determined by X-ray diffraction at 1.55 Å resolution. Released 16 Oct 2024.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Homo sapiens
Chains: 1
Atoms: 936
Mol. weight: 12.81 kDa
Ligands: BA
Released: 16 Oct 2024

Explore 9B3G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9B3G contains 4 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	795-797	3
β-strand	805-807	3	1
β-strand	814-816	3	1
β-strand	821-822	2	2
β-strand	828-829	2	2
α-helix	842	1
β-strand	843-846	4	3
β-strand	853-856	4	3
α-helix	857-858	2
β-strand	861-862	2	4
β-strand	868-869	2	4
β-strand	883-887	5	5
β-strand	890-894	5	5
α-helix	895-896	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neurogenic locus notch homolog protein 1	A	protein	119	Homo sapiens	P46531 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9B3G_1 Neurogenic locus notch homolog protein 1 (chains A)
SATNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQS
EDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHGGYRCHCQAGYSGRNCET

Ligands and cofactors

ID	Name	Formula	Copies
BA	Barium ion	Ba	1

Primary citation

Structural and functional studies of the EGF20-27 region reveal new features of the human Notch receptor important for optimal activation. Bo, Z., Rowntree, T., Johnson, S. et al. Structure (2024) 32:2325-2336.e5. DOI 10.1016/j.str.2024.10.012 · PubMed

Other PDB entries of the same protein (UniProt P46531 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5L0R 1.5 Å, human POGLUT1 in complex with Notch1 EGF12 and UDP
9B3N 1.5 Å, Human Notch-1 EGFs 20-24
2F8Y 1.55 Å, Crystal structure of human Notch1 ankyrin repeats to 1.55A resolution.
4D0E 1.61 Å, Human Notch1 EGF domains 11-13 mutant GlcNAc-fucose disaccharide modified at T466
4CUD 1.85 Å, Human Notch1 EGF domains 11-13 mutant fucosylated at T466
2HE0 1.9 Å, Crystal structure of a human Notch1 ankyrin domain mutant
1YYH 1.9 Å, Crystal structure of the human Notch 1 ankyrin domain
3ETO 2.0 Å, 2 Angstrom Xray structure of the NOTCH1 Negative Regulatory Region (NRR)
5UB5 2.09 Å, human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP
3L95 2.19 Å, Crystal structure of the human Notch1 Negative Regulatory Region (NRR) bound to the fab…
4CUF 2.29 Å, Human Notch1 EGF domains 11-13 mutant T466S
5FMA 2.46 Å, human Notch 1, EGF 4-7

Browse structure collections

About this viewer

MolViewer shows 9B3G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.