1YZE: N-terminal domain of USP7/HAUSP

Crystal structure of the N-terminal domain of USP7/HAUSP. Determined by X-ray diffraction at 2.0 Å resolution. Released 5 Apr 2005.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,537
Mol. weight: 54.4 kDa
Released: 5 Apr 2005

Explore 1YZE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1YZE contains 3 α-helices and 28 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	68-75	8	1
β-strand	86	1	2
β-strand	90-92	3	2
β-strand	95-102	8	2
β-strand	116-121	6	2
β-strand	131-140	10	1
β-strand	151-159	9	1
β-strand	164-167	4	2
β-strand	189-197	9	1

Chain B: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	68-74	7	3
β-strand	90-92	3	4
β-strand	95-102	8	4
β-strand	116-121	6	4
β-strand	131-140	10	3
β-strand	151-159	9	3
β-strand	164-167	4	4
β-strand	190-197	8	3
α-helix	198-200	3
β-strand	201	1	3

Chain C: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	68-73	6	5
β-strand	86	1	6
β-strand	90-92	3	6
β-strand	95-101	7	6
β-strand	117-121	5	6
β-strand	131-140	10	5
β-strand	151-159	9	5
α-helix	160-162	3
β-strand	164-167	4	6
β-strand	191-197	7	5
α-helix	198-200	3
β-strand	201	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin carboxyl-terminal hydrolase 7	A, B, C	protein	155	Homo sapiens	Q93009 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1YZE_1 Ubiquitin carboxyl-terminal hydrolase 7 (chains A, B, C)
GSHTAEEDMEDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRP
HQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNF
MAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAW

Primary citation

Structure of the p53 binding domain of HAUSP/USP7 bound to Epstein-Barr nuclear antigen 1 implications for EBV-mediated immortalization. Saridakis, V., Sheng, Y., Sarkari, F. et al. Mol Cell (2005) 18:25-36. DOI 10.1016/j.molcel.2005.02.029 · PubMed

Other PDB entries of the same protein (UniProt Q93009 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4YSI 1.02 Å, Structure of USP7 with a novel viral protein
5KYC 1.43 Å, Crystal structure of USP7 catalytic domain [V302K] mutant in complex with ubiquitin…
5KYF 1.45 Å, Crystal structure of USP7 catalytic domain [L299A] mutant in complex with ubiquitin
2FOJ 1.6 Å, The Crystal Structure of the N-terminal domain of HAUSP/USP7 complexed with p53 peptide…
2XXN 1.6 Å, Structure of the vIRF4-HAUSP TRAF domain complex
5KYD 1.62 Å, Crystal structure of USP7 catalytic domain [V302K] mutant in complex with ubiquitin
12ZJ 1.63 Å, Crystal structure of USP7 TRAF domain in complex with MAGEL2 peptide (968-980)
2F1W 1.65 Å, Crystal structure of the TRAF-like domain of HAUSP/USP7
1YY6 1.7 Å, The Crystal Structure of the N-terminal domain of HAUSP/USP7 complexed with an EBNA1…
2F1Y 1.7 Å, Crystal structure of the TRAF-like domain of HAUSP/USP7 bound to a MDM2 peptide
4KG9 1.7 Å, Crystal Structure Of USP7-NTD with MCM-BP
5N9T 1.73 Å, Crystal structure of USP7 in complex with a potent, selective and reversible…

Browse structure collections

About this viewer

MolViewer shows 1YZE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.