1Z1D: Replication protein A 32 kDa subunit

Name: PDB 1Z1D: Structural Model for the interaction between RPA32 C-terminal domain and SV40 T antigen origin binding domain.
Published: 2005-05-17
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: replication

Structural Model for the interaction between RPA32 C-terminal domain and SV40 T antigen origin binding domain. Determined by solution NMR. Released 17 May 2005.

Method: Solution NMR
Organisms: Homo sapiens, Simian virus 40
Chains: 2
Atoms: 1,603
Mol. weight: 26.11 kDa
Released: 17 May 2005

Explore 1Z1D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Z1D contains 7 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	207-217	11
β-strand	225-226	2	1
α-helix	227-233	7
α-helix	239-251	13
β-strand	255-257	3	1
β-strand	263-266	4	1

Chain B: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	12-15	4
β-strand	18	1	2
β-strand	27-35	9	3
α-helix	37-51	15
β-strand	55-60	6	3
β-strand	65-76	12	3
α-helix	77-86	10
β-strand	94-97	4	3
β-strand	98	1	2
α-helix	101-107	7
β-strand	114-118	5	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Replication protein A 32 kDa subunit	A	protein	103	Homo sapiens	P15927 (AlphaFold model)
Large T antigen	B	protein	131	Simian virus 40	P03070 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1Z1D_1 Replication protein A 32 kDa subunit (chains A)
GSHMANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNF
QDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE

Sequence of entity 2 (B), FASTA

>1Z1D_2 Large T antigen (chains B)
GSKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHN
SYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEESL
PGGLKEHDFNP

Primary citation

Insights into hRPA32 C-terminal domain--mediated assembly of the simian virus 40 replisome. Arunkumar, A.I., Klimovich, V., Jiang, X. et al. Nat Struct Mol Biol (2005) 12:332-339. DOI 10.1038/nsmb916 · PubMed

Other PDB entries of the same protein (UniProt P15927 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4OU0 1.4 Å, Crystal Structure of RPA32C
4MQV 1.95 Å, Crystal complex of Rpa32c and Smarcal1 N-terminus
3KDF 1.98 Å, X-ray Crystal Structure of the Human Replication Protein A Complex from Wheat Germ Cell…
2PI2 2.0 Å, Full-length Replication protein A subunits RPA14 and RPA32
1QUQ 2.5 Å, Complex of replication protein A subunits RPA14 and RPA32
2PQA 2.5 Å, Crystal Structure of Full-length Human RPA 14/32 Heterodimer
1L1O 2.8 Å, Structure of the human Replication Protein A (RPA) trimerization core
2Z6K 3.0 Å, Crystal structure of full-length human RPA14/32 heterodimer
8RK2 3.2 Å, Human Replication protein A (RPA; trimeric core) - ssDNA complex
9PD3 3.3 Å, NER dual incision complex - DuIS
9PD4 3.4 Å, NER dual incision complex - DuIM
9MJ5 3.5 Å, Catalytic domain of human DNA polymerase alpha in complex with DNA and RPA

Browse structure collections

About this viewer

MolViewer shows 1Z1D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.