4MQV: Replication protein A 32 kDa subunit

Crystal complex of Rpa32c and Smarcal1 N-terminus. Determined by X-ray diffraction at 1.95 Å resolution. Released 2 Jul 2014.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,620
Mol. weight: 21.56 kDa
Released: 2 Jul 2014

Explore 4MQV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4MQV contains 8 α-helices and 6 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	207-218	12
β-strand	225-226	2	1
α-helix	227-233	7
α-helix	239-251	13
β-strand	255-257	3	1
β-strand	263-266	4	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	7-29	23

Chain C: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	207-217	11
β-strand	225-226	2	2
α-helix	227-233	7
α-helix	239-251	13
β-strand	255-257	3	2
β-strand	263-266	4	2

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	7-25	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Replication protein A 32 kDa subunit	A, C	protein	69	Homo sapiens	P15927 (AlphaFold model)
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1	B, D	protein	26	Homo sapiens	Q9NZC9 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4MQV_1 Replication protein A 32 kDa subunit (chains A, C)
ANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDD
DHFKSTDAE

Sequence of entity 2 (B, D), FASTA

>4MQV_2 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 (chains B, D)
LTEEQRKKIEENRQKALARRAEKLLA

Primary citation

Structure of RPA32 bound to the N-terminus of SMARCAL1 redefines the binding interface between RPA32 and its interacting proteins. Xie, S., Lu, Y., Jakoncic, J. et al. FEBS J (2014) 281:3382-3396. DOI 10.1111/febs.12867 · PubMed

Other PDB entries of the same protein (UniProt P15927 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4OU0 1.4 Å, Crystal Structure of RPA32C
3KDF 1.98 Å, X-ray Crystal Structure of the Human Replication Protein A Complex from Wheat Germ Cell…
2PI2 2.0 Å, Full-length Replication protein A subunits RPA14 and RPA32
1QUQ 2.5 Å, Complex of replication protein A subunits RPA14 and RPA32
2PQA 2.5 Å, Crystal Structure of Full-length Human RPA 14/32 Heterodimer
1L1O 2.8 Å, Structure of the human Replication Protein A (RPA) trimerization core
2Z6K 3.0 Å, Crystal structure of full-length human RPA14/32 heterodimer
8RK2 3.2 Å, Human Replication protein A (RPA; trimeric core) - ssDNA complex
9PD3 3.3 Å, NER dual incision complex - DuIS
9PD4 3.4 Å, NER dual incision complex - DuIM
9MJ5 3.5 Å, Catalytic domain of human DNA polymerase alpha in complex with DNA and RPA
1DPU Solution structure of the C-terminal domain of human RPA32 complexed with UNG2(73-88)

Browse structure collections

About this viewer

MolViewer shows 4MQV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.