4OU0: RPA32C

Crystal Structure of RPA32C. Determined by X-ray diffraction at 1.4 Å resolution. Released 30 Apr 2014.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 581
Mol. weight: 8 kDa
Released: 30 Apr 2014

Explore 4OU0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4OU0 contains 3 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	207-218	12
β-strand	225-226	2	1
α-helix	227-233	7
α-helix	239-252	14
β-strand	255-257	3	1
β-strand	263-266	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Replication protein A 32 kDa subunit	A	protein	73	Homo sapiens	P15927 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4OU0_1 Replication protein A 32 kDa subunit (chains A)
GPGSANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYS
TVDDDHFKSTDAE

Primary citation

Structural Analysis of Replication Protein A Recruitment of the DNA Damage Response Protein SMARCAL1. Feldkamp, M.D., Mason, A.C., Eichman, B.F. et al. Biochemistry (2014) 53:3052-3061. DOI 10.1021/bi500252w · PubMed

Other PDB entries of the same protein (UniProt P15927 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4MQV 1.95 Å, Crystal complex of Rpa32c and Smarcal1 N-terminus
3KDF 1.98 Å, X-ray Crystal Structure of the Human Replication Protein A Complex from Wheat Germ Cell…
2PI2 2.0 Å, Full-length Replication protein A subunits RPA14 and RPA32
1QUQ 2.5 Å, Complex of replication protein A subunits RPA14 and RPA32
2PQA 2.5 Å, Crystal Structure of Full-length Human RPA 14/32 Heterodimer
1L1O 2.8 Å, Structure of the human Replication Protein A (RPA) trimerization core
2Z6K 3.0 Å, Crystal structure of full-length human RPA14/32 heterodimer
8RK2 3.2 Å, Human Replication protein A (RPA; trimeric core) - ssDNA complex
9PD3 3.3 Å, NER dual incision complex - DuIS
9PD4 3.4 Å, NER dual incision complex - DuIM
9MJ5 3.5 Å, Catalytic domain of human DNA polymerase alpha in complex with DNA and RPA
1DPU Solution structure of the C-terminal domain of human RPA32 complexed with UNG2(73-88)

Browse structure collections

About this viewer

MolViewer shows 4OU0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.