1Z7Z: Human coxsackievirus A21

Cryo-em structure of human coxsackievirus A21 complexed with five domain icam-1kilifi. Determined by electron microscopy at 8.0 Å resolution. Released 2 Aug 2005.

Method: Electron microscopy
Resolution: 8.0 Å
Organisms: Human coxsackievirus A21, Homo sapiens
Chains: 6
Atoms: 8,824
Mol. weight: 140.66 kDa
Ligands: NAG
Released: 2 Aug 2005

Explore 1Z7Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Z7Z contains 34 α-helices and 98 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 1: 9 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	80-89	10	1
β-strand	100-104	5	2
α-helix	111-117	7
β-strand	120-136	17	1
α-helix	146-148	3
β-strand	149-155	7	2
α-helix	168-171	4
β-strand	177-181	5	2
α-helix	185-187	3
β-strand	188-191	4	1
β-strand	200-201	2	1
β-strand	206	1	3
β-strand	207	1	4
α-helix	210-211	2
β-strand	212	1	5
α-helix	221-223	3
β-strand	224	1	4
α-helix	225-229	5
β-strand	234-239	6	2
α-helix	242-243	2
β-strand	248-266	19	1
α-helix	268-270	3

Chain 2: 10 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	14-18	5	6
β-strand	21-25	5	6
β-strand	32-33	2	7
α-helix	34-36	3
α-helix	52-53	2
β-strand	54	1	7
α-helix	57-59	3
β-strand	64-65	2	7
α-helix	66-68	3
β-strand	69-72	4	8
β-strand	78-82	5	9
α-helix	84-86	3
α-helix	90-98	9
β-strand	99-111	13	7
β-strand	118-128	11	9
α-helix	132-133	2
β-strand	134	1	10
α-helix	145-148	4
β-strand	155-156	2	9
β-strand	158	1	11
β-strand	174	1	10
β-strand	177	1	11
α-helix	178-180	3
α-helix	187-192	6
β-strand	195-199	5	9
β-strand	205-210	6	7
β-strand	219	1	7
β-strand	224	1	3
β-strand	227-239	13	9
β-strand	246-249	4	8
β-strand	250-263	14	7
β-strand	269	1	5

Chain 3: 6 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	44-47	4
β-strand	51-52	2	12
β-strand	58	1	13
α-helix	65-67	3
β-strand	69-73	5	12
β-strand	83-85	3	14
α-helix	98-103	6
β-strand	106-110	5	15
α-helix	112	1
β-strand	113-119	7	12
β-strand	126	1	16
β-strand	128-134	7	14
α-helix	144-148	5
β-strand	151-156	6	14
α-helix	157	1
β-strand	162-167	6	12
β-strand	176-177	2	15
β-strand	188-193	6	14
β-strand	198	1	16
β-strand	206-215	10	12
β-strand	220-224	5	15

Chain 4: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	290-291	2
β-strand	292	1	13

Chain I: 8 helices, 47 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	17
β-strand	8-12	5	18
β-strand	15-22	8	17
β-strand	30-33	4	19
β-strand	39-41	3	17
β-strand	49-57	9	17
β-strand	61	1	18
β-strand	64-69	6	19
β-strand	72-77	6	19
β-strand	79-83	5	18
β-strand	84	1	20
β-strand	88-91	4	21
α-helix	92-93	2
β-strand	97-98	2	22
β-strand	103-111	9	21
β-strand	114	1	20
α-helix	116-118	3
β-strand	119-125	7	23
β-strand	128-134	7	23
β-strand	140-147	8	21
β-strand	156-164	9	23
α-helix	166-168	3
β-strand	172-176	5	23
β-strand	180-181	2	23
β-strand	183-184	2	22
α-helix	191-192	2
β-strand	193-195	3	24
β-strand	199-201	3	25
β-strand	205-213	9	24
α-helix	218-220	3
β-strand	222-227	6	25
β-strand	230-231	2	25
β-strand	235-239	5	24
β-strand	242-250	9	24
α-helix	253-255	3
β-strand	257-267	11	25
β-strand	270-281	12	25
β-strand	287-290	4	26
β-strand	294-296	3	27
β-strand	300-306	7	26
β-strand	329-332	4	26
α-helix	335-337	3
β-strand	341-350	10	28
β-strand	353-362	10	28
β-strand	364-366	3	27
β-strand	367-370	4	29
β-strand	379-383	5	30
β-strand	387-388	2	31
β-strand	395-397	3	29
β-strand	401-406	6	30
β-strand	410-411	2	30
β-strand	418-419	2	31
α-helix	422-424	3
β-strand	426-434	9	30
β-strand	437-448	12	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
human coxsackievirus A21	1	protein	286	Human coxsackievirus A21	Q7T7N6 (AlphaFold model)
human coxsackievirus A21	2	protein	272	Human coxsackievirus A21	Q7T7N6 (AlphaFold model)
human coxsackievirus A21	3	protein	234	Human coxsackievirus A21	Q7T7N6 (AlphaFold model)
human coxsackievirus A21	4	protein	12	Human coxsackievirus A21	P22055
human coxsackievirus A21	5	protein	6	Human coxsackievirus A21
Intercellular adhesion molecule-1	I	protein	450	Homo sapiens	P05362 (AlphaFold model)

Sequence of entity 1 (1), FASTA

>1Z7Z_1 human coxsackievirus A21 (chains 1)
GIEDLIDTAIKNALRVSQPPSTQSTEATSGVNSQEVPALTAVETGASGQAIPSDVVETRH
VVNYKTRSESCLESFFGRAACVTILSLTNSSKSGEEKKHFNIWNITYTDTVQLRRKLEFF
TYSRFDLEMTFVFTENYPSTASGEVRNQVYQIMYIPPGAPRPSSWDDYTWQSSSNPSIFY
MYGNAPPRMSIPYVGIANAYSHFYDGFARVPLEGENTDAGDTFYGLVSINDFGVLAVRAV
NRSNPHTIHTSVRVYMKPKHIRCWCPRPPRAVLYRGEGVDMISSAI

Sequence of entity 2 (2), FASTA

>1Z7Z_2 human coxsackievirus A21 (chains 2)
SPNVEACGYSDRVRQITLGNSTITTQEAANAIVAYGEWPTYINDSEANPVDAPTEPDVSS
NRFYTLESVSWKTTSRGWWWKLPDCLKDMGMFGQNMYYHYLGRSGYTIHVQCNASKFHQG
ALGVFLIPEFVMACNTESKTSYVSYINANPGERGGEFTNTYNPSNTDASEGRKFAALDYL
LGSGVLAGNAFVYPHQIINLRTNNSATIVVPYVNSLVIDCMAKHNNWGIVILPLAPLAFA
ATSSPQVPITVTIAPMCTEFNGLRNITVPVHQ

Sequence of entity 3 (3), FASTA

>1Z7Z_3 human coxsackievirus A21 (chains 3)
GLPTMNTPGSNQFLTSDDFQSPCALPNFDVTPPIHIPGEVKNMMELAEIDTLIPMNAVDG
KVNTMEMYQIPLNDNLSKAPIFCLSLSPASDKRLSHTMLGEILNYYTHWTGSIRFTFLFC
GSMMATGKLLLSYSPPGAKPPTNRKDAMLGTHIIWDLGLQSSCSMVAPWISNTVYRRCAR
DDFTEGGFITCFYQTRIVVPASTPTSMFMLGFVSACPDFSVRLLKDTPHISQSK

Sequence of entity 4 (4), FASTA

>1Z7Z_4 human coxsackievirus A21 (chains 4)
LPLTKVDSITTF

Sequence of entity 5 (5), FASTA

>1Z7Z_5 human coxsackievirus A21 (chains 5)
LIGRTQ

Sequence of entity 6 (I), FASTA

>1Z7Z_6 Intercellular adhesion molecule-1 (chains I)
QTSVSPSKVILPRGGSVLVTCSTSCDQPMLLGIETPLPKKELLLPGNNRKVYELSNVQED
SQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLT
VVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPY
QLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGN
DSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTE
VTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQT
RELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTV
TRDLEGTYLCRARSTQGEVTREVTVNVLSP

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	8

Primary citation

The crystal structure of coxsackievirus a21 and its interaction with icam-1. Xiao, C., Bator-Kelly, C.M., Rieder, E. et al. Structure (2005) 13:1019-1033. DOI 10.1016/j.str.2005.04.011 · PubMed

Other PDB entries of the same protein (UniProt Q7T7N6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7TQU 3.8 Å, Coxsackievirus A21 capsid subdomain in complex with mouse polyclonal antibody pAbC-1
7TQS 3.9 Å, Coxsackievirus A21 capsid subdomain in complex with mouse polyclonal antibody pAbC-3
7TQT 4.1 Å, Coxsackievirus A21 capsid subdomain in complex with mouse polyclonal antibody pAbC-5

Browse structure collections

About this viewer

MolViewer shows 1Z7Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.