1ZA6: Antitumor CH2-domain-deleted humanized antibody

The structure of an antitumor CH2-domain-deleted humanized antibody. Determined by X-ray diffraction at 2.8 Å resolution. Released 10 May 2005.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 8
Atoms: 16,740
Mol. weight: 244.64 kDa
Released: 10 May 2005

Explore 1ZA6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ZA6 contains 71 α-helices and 237 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-14	5	2
β-strand	19-25	7	1
β-strand	30-31	2	3
β-strand	36-37	2	3
β-strand	39-44	6	2
β-strand	51-55	5	2
β-strand	59-60	2	2
β-strand	68-73	6	1
β-strand	76-81	6	1
α-helix	86-88	3
β-strand	91-96	6	2
α-helix	102	1
β-strand	103-104	2	2
β-strand	105	1	1
β-strand	108-113	6	2
β-strand	117	1	4
β-strand	121-124	4	5
α-helix	125-127	3
α-helix	128-133	6
β-strand	135-145	11	5
β-strand	146	1	4
β-strand	151	1	6
β-strand	154-156	3	7
β-strand	160	1	7
β-strand	165-169	5	5
α-helix	170-173	4
β-strand	179-188	10	5
α-helix	189-194	6
β-strand	197-202	6	7
β-strand	203	1	6
β-strand	211-216	6	7

Chain B: 11 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	8
α-helix	7-9	3
β-strand	10-12	3	9
β-strand	18-25	8	8
β-strand	34-39	6	9
β-strand	45-52	8	9
β-strand	57-60	4	9
β-strand	65	1	8
β-strand	68-73	6	8
β-strand	78-83	6	8
α-helix	88-90	3
β-strand	92-98	7	9
β-strand	104-105	2	9
β-strand	109-113	5	9
α-helix	117-118	2
β-strand	119	1	10
β-strand	122-126	5	11
β-strand	137-147	11	11
β-strand	148	1	10
β-strand	154-156	3	12
β-strand	161	1	12
β-strand	165-167	3	11
α-helix	168-170	3
β-strand	171-172	2	11
β-strand	178-187	10	11
α-helix	190-193	4
β-strand	194	1	13
β-strand	196-202	7	12
α-helix	203-205	3
β-strand	207-213	7	12
β-strand	241	1	14
α-helix	242-243	2
β-strand	244-248	5	15
α-helix	252-256	5
β-strand	260-269	10	15
β-strand	270	1	14
β-strand	275-279	5	16
α-helix	284-285	2
β-strand	288-290	3	15
α-helix	291-293	3
β-strand	294-295	2	15
β-strand	301-309	9	15
α-helix	311-315	5
β-strand	319-325	7	16
β-strand	333-339	7	16

Chain C: 7 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	17
β-strand	10-14	5	18
β-strand	19-25	7	17
β-strand	30-31	2	19
β-strand	36-37	2	19
β-strand	39-44	6	18
β-strand	51-55	5	18
β-strand	59-60	2	18
β-strand	68-73	6	17
β-strand	76-81	6	17
α-helix	86-88	3
β-strand	90-96	7	18
α-helix	102	1
β-strand	103-104	2	18
β-strand	108-113	6	18
α-helix	118-119	2
β-strand	120-124	5	20
α-helix	125-127	3
α-helix	128-132	5
β-strand	135-145	11	20
β-strand	152-156	5	21
β-strand	159-160	2	21
β-strand	165-169	5	20
α-helix	170-173	4
β-strand	179-188	10	20
α-helix	189-193	5
β-strand	197-202	6	21
β-strand	211-216	6	21

Chain D: 13 helices, 36 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	22
α-helix	7-9	3
β-strand	10-12	3	23
β-strand	18-25	8	22
α-helix	29-31	3
β-strand	34-39	6	23
β-strand	45-52	8	23
β-strand	57-60	4	23
β-strand	65	1	22
β-strand	68-73	6	22
β-strand	78-83	6	22
α-helix	88-90	3
β-strand	92-98	7	23
β-strand	105	1	23
β-strand	109-113	5	23
α-helix	116-118	3
β-strand	119	1	24
α-helix	120-121	2
β-strand	122-126	5	25
β-strand	137-147	11	25
β-strand	148	1	24
β-strand	153-156	4	26
α-helix	157-159	3
β-strand	165-167	3	25
α-helix	168-170	3
β-strand	171-172	2	25
β-strand	178-187	10	25
β-strand	191	1	27
β-strand	194	1	27
β-strand	197	1	28
β-strand	198-202	5	26
α-helix	203-205	3
β-strand	207-209	3	26
β-strand	212	1	28
β-strand	241	1	29
α-helix	242-243	2
β-strand	244-248	5	30
α-helix	254-256	3
β-strand	260-269	10	30
β-strand	270	1	29
β-strand	275-279	5	31
α-helix	284-285	2
β-strand	290	1	30
α-helix	291-293	3
β-strand	294-295	2	30
β-strand	301-309	9	30
α-helix	311-314	4
β-strand	319-325	7	31
β-strand	333-339	7	31

Chain E: 5 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	32
β-strand	10-14	5	33
β-strand	19-25	7	32
β-strand	30-31	2	34
β-strand	36-37	2	34
β-strand	39-44	6	33
β-strand	51-55	5	33
β-strand	59-60	2	33
β-strand	68-73	6	32
β-strand	76-81	6	32
β-strand	91-96	6	33
α-helix	102	1
β-strand	103-104	2	33
β-strand	105	1	32
β-strand	108-113	6	33
β-strand	121-124	4	35
α-helix	125-127	3
α-helix	128-133	6
β-strand	135-145	11	35
β-strand	151-156	6	36
β-strand	159-161	3	36
β-strand	165-169	5	35
α-helix	170-173	4
β-strand	179-188	10	35
α-helix	189-193	5
β-strand	197-203	7	36
β-strand	211-216	6	36

Chain F: 11 helices, 38 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	37
β-strand	10-12	3	33
β-strand	18-25	8	37
β-strand	34-39	6	33
β-strand	45-52	8	33
β-strand	57-60	4	33
α-helix	62-64	3
β-strand	65	1	38
β-strand	68	1	38
β-strand	70-73	4	37
β-strand	78-83	6	37
β-strand	92-98	7	33
β-strand	104-105	2	33
β-strand	109-113	5	33
α-helix	117-118	2
β-strand	119	1	39
α-helix	120-121	2
β-strand	122-126	5	40
β-strand	137-147	11	40
β-strand	148	1	39
β-strand	153-156	4	41
α-helix	157-159	3
β-strand	161	1	41
β-strand	166-167	2	40
α-helix	168-170	3
β-strand	171-172	2	40
β-strand	178-187	10	40
β-strand	191	1	42
β-strand	194	1	42
β-strand	196-197	2	43
β-strand	198-202	5	41
α-helix	203-205	3
β-strand	207-209	3	41
α-helix	211	1
β-strand	212-213	2	43
β-strand	241	1	44
α-helix	242-243	2
β-strand	244-248	5	45
α-helix	252-256	5
β-strand	260-269	10	45
β-strand	270	1	44
β-strand	275-279	5	46
α-helix	284-285	2
β-strand	288-290	3	45
β-strand	294-295	2	45
β-strand	301-309	9	45
α-helix	311-315	5
β-strand	320-325	6	46
β-strand	333-338	6	46

Chain G: 5 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	47
β-strand	10-14	5	48
β-strand	19-25	7	47
β-strand	30-31	2	49
β-strand	36-37	2	49
β-strand	39-44	6	48
β-strand	51-55	5	48
β-strand	59-60	2	48
β-strand	68-73	6	47
β-strand	76-81	6	47
α-helix	86-88	3
β-strand	90-96	7	48
α-helix	102	1
β-strand	103-104	2	48
β-strand	105	1	47
β-strand	108-113	6	48
β-strand	117	1	50
β-strand	120-124	5	51
α-helix	125-127	3
α-helix	128-133	6
β-strand	135-145	11	51
β-strand	146	1	50
β-strand	151-156	6	52
β-strand	159-161	3	52
β-strand	165-169	5	51
β-strand	179-188	10	51
α-helix	189-194	6
β-strand	197-203	7	52
β-strand	211-216	6	52

Chain H: 13 helices, 36 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	53
α-helix	7-9	3
β-strand	10-12	3	54
β-strand	18-25	8	53
α-helix	29-31	3
β-strand	34-39	6	54
β-strand	45-52	8	54
β-strand	57-60	4	54
α-helix	62-64	3
β-strand	65	1	53
β-strand	68-73	6	53
α-helix	74-76	3
β-strand	78-83	6	53
α-helix	88-90	3
β-strand	92-98	7	54
β-strand	104-105	2	54
β-strand	109-113	5	54
β-strand	119	1	55
α-helix	120-121	2
β-strand	122-126	5	56
β-strand	137-147	11	56
β-strand	148	1	55
β-strand	153-156	4	57
α-helix	157-159	3
β-strand	161	1	57
β-strand	166-167	2	56
α-helix	168-170	3
β-strand	171-172	2	56
β-strand	178-187	10	56
β-strand	191	1	58
β-strand	194	1	58
β-strand	196-197	2	59
β-strand	198-202	5	57
α-helix	203-205	3
β-strand	207-209	3	57
β-strand	212-213	2	59
β-strand	244-248	5	60
α-helix	249-251	3
α-helix	252-254	3
β-strand	260-269	10	60
β-strand	277-279	3	61
β-strand	284	1	61
α-helix	285	1
β-strand	288-290	3	60
β-strand	294-295	2	60
β-strand	301-309	9	60
α-helix	311-315	5
β-strand	320-325	6	61
β-strand	333-338	6	61

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IGG Light chain	A, C, E, G	protein	220	Homo sapiens	P01834 (AlphaFold model)
IGG Heavy chain	B, D, F, H	protein	344	Homo sapiens	A0A2R9ARU9 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>1ZA6_1 IGG Light chain (chains A, C, E, G)
DIVMSQSPDSLAVSLGERVTLNCKSSQSLLYSGNQKNYLAWYQQKPGQSPKLLIYWASAR
ESGVPDRFSGSGSGTDFTLTISSVQAEDVAVYYCQQYYSYPLTFGAGTKLELKRTVAAPS
VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYS
LSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 2 (B, D, F, H), FASTA

>1ZA6_2 IGG Heavy chain (chains B, D, F, H)
QVQLVQSGAEVVKPGASVKISCKASGYTFTDHAIHWVKQNPGQRLEWIGYFSPGNDDFKY
NERFKGKATLTADTSASTAYVELSSLRSEDTAVYFCTRSLNMAYWGQGTLVTVSSASTKG
PSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL
SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCGGGSSGGGSGGQP
REPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS
FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Primary citation

The Structure of an Antitumor C(H)2-domain-deleted Humanized Antibody. Larson, S.B., Day, J.S., Glaser, S. et al. J Mol Biol (2005) 348:1177-1190. DOI 10.1016/j.jmb.2005.03.036 · PubMed

Other PDB entries of the same protein (UniProt P01834 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5EWI 1.6 Å, Crystal Structure of the Human Fab VRC38.01, an HIV-1 V1V2-Directed Neutralizing…
1NGZ 1.6 Å, Chimeric Germline Fab 7g12-apo
6N35 1.75 Å, Anti-HIV-1 Fab 2G12 + Man1-2 re-refinement
4XMP 1.78 Å, Crystal structure of broadly and potently neutralizing antibody VRC08 in complex with…
1N0X 1.8 Å, Crystal Structure of a Broadly Neutralizing Anti-HIV-1 Antibody in Complex with a…
3VH8 1.8 Å, KIR3DL1 in complex with HLA-B*5701
3X12 1.8 Å, Crystal structure of HLA-B*57:01.I80N
6B9Z 1.82 Å, Trastuzumab Fab v3
2VXQ 1.9 Å, Crystal structure of the major grass pollen allergen Phl p 2 in complex with its…
3D85 1.9 Å, Crystal structure of IL-23 in complex with neutralizing FAB
6BAH 1.9 Å, Trastuzumab Fab v3 with 5-diphenyl meditope variant
6DCV 1.9 Å, Crystal structure of human anti-tau antibody CBTAU-27.1

Browse structure collections

About this viewer

MolViewer shows 1ZA6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.