1ZGX: Ribonuclease mutant

Crystal structure of ribonuclease mutant. Determined by X-ray diffraction at 1.13 Å resolution. Released 8 Aug 2006.

Method: X-ray diffraction
Resolution: 1.13 Å
Organism: Streptomyces aureofaciens
Chains: 2
Atoms: 1,004
Mol. weight: 10.89 kDa
Released: 8 Aug 2006

Explore 1ZGX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ZGX contains 6 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	1
α-helix	8-10	3
α-helix	13-24	12
α-helix	35	1
β-strand	36	1	1
α-helix	37	1
α-helix	45-46	2
β-strand	53-56	4	1
α-helix	58-59	2

Chain B: 0 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	69-72	4	1
β-strand	79-82	4	1
β-strand	90-93	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Guanyl-specific ribonuclease Sa	A	protein	63	Streptomyces aureofaciens	P05798 (AlphaFold model)
Guanyl-specific ribonuclease Sa	B	protein	33	Streptomyces aureofaciens	P05798 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1ZGX_1 Guanyl-specific ribonuclease Sa (chains A)
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITP
GAR

Sequence of entity 2 (B), FASTA

>1ZGX_2 Guanyl-specific ribonuclease Sa (chains B)
TRGTRRIITGEATQEDYYTGDHYATFSLIDKTC

Primary citation

Surface mutation Gln to Lys changed the crystal packing. Urbanikova, L., Sevcik, J. To be published.

Other PDB entries of the same protein (UniProt P05798 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LNI 1.0 Å, Crystal structure analysis of a ribonuclease from streptomyces aureofaciens at atomic…
1T2H 1.0 Å, Y81W mutant of RNase Sa from Streptomyces aureofaciens
1T2I 1.1 Å, T76W mutant of RNase Sa from Streptomyces aureofaciens
4GHO 1.1 Å, Crystal Structure Analysis of Streptomyces aureofaciens Ribonuclease S24A mutant
1RGE 1.15 Å, Hydrolase, guanyloribonuclease
1RGF 1.2 Å, Hydrolase, guanyloribonuclease
1RGG 1.2 Å, Hydrolase, guanyloribonuclease
1RGH 1.2 Å, Hydrolase, guanyloribonuclease
1YNV 1.2 Å, Asp79 makes a large, unfavorable contribution to the stability of RNase Sa
4J5K 1.23 Å, Crystal structure analysis of Streptomyces aureofaciens ribonuclease Sa Y51F mutant
1I8V 1.25 Å, Crystal structure of RNase sa Y80F mutant
4J5G 1.31 Å, Crystal structure analysis of Streptomyces aureofaciens ribonuclease Sa T95A mutant

Browse structure collections

About this viewer

MolViewer shows 1ZGX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.