Crystal structure of N-ColE7/12-bp DNA/Zn complex. Determined by X-ray diffraction at 2.5 Å resolution. Released 14 Mar 2006.
Explore 1ZNS in 3D Show helices and sheets RCSB PDB PDBe
1ZNS contains 8 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 451-452 | 2 | 1 |
| β-strand | 454 | 1 | 2 |
| β-strand | 474-475 | 2 | 3 |
| α-helix | 478-484 | 7 | |
| β-strand | 488-489 | 2 | 1 |
| α-helix | 492-505 | 14 | |
| α-helix | 507-510 | 4 | |
| α-helix | 515-522 | 8 | |
| α-helix | 525-527 | 3 | |
| β-strand | 528 | 1 | 4 |
| α-helix | 529-530 | 2 | |
| α-helix | 531-533 | 3 | |
| β-strand | 535 | 1 | 5 |
| β-strand | 538 | 1 | 5 |
| β-strand | 540 | 1 | 4 |
| β-strand | 542-545 | 4 | 3 |
| β-strand | 557 | 1 | 2 |
| β-strand | 561-564 | 4 | 3 |
| α-helix | 566-573 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 5'-d(*cp*gp*gp*gp*ap*tp*ap*tp*cp*cp*cp*g)-3' | B, C | DNA | 12 | ||
| Colicin E7 | A | protein | 134 | Escherichia coli str. K12 substr. | Q47112 (AlphaFold model) |
>1ZNS_1 5'-D(*CP*GP*GP*GP*AP*TP*AP*TP*CP*CP*CP*G)-3' (chains B, C) CGGGATATCCCG
>1ZNS_2 Colicin E7 (chains A) MESKRNKPGKATGKGKPVNNKWLNNAGKDLGSPVPDRIANKLRDKEFKSFDDFRKKFWEE VSKDPELSKQFSRNNNDRMKVGKAPKTRTQDVSGKRTSFELHEEKPISQNGGVYDMDNIS VVTPKRHIDIHRGK
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Crystal structural analysis and metal-dependent stability and activity studies of the ColE7 endonuclease domain in complex with DNA/Zn2+ or inhibitor/Ni2+. Doudeva, L.G., Huang, H., Hsia, K.C. et al. Protein Sci (2006) 15:269-280. DOI 10.1110/ps.051903406 · PubMed
Other PDB entries of the same protein (UniProt Q47112 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1ZNS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.