1ZOK: PDZ1 Domain Of Synapse Associated Protein 97

PDZ1 Domain Of Synapse Associated Protein 97. Determined by solution NMR. Released 7 Jun 2005.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 1
Atoms: 709
Mol. weight: 10.09 kDa
Released: 7 Jun 2005

Explore 1ZOK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ZOK contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	222	1	1
β-strand	225-227	3	2
β-strand	236-239	4	3
β-strand	254-258	5	3
α-helix	263-267	5
β-strand	278-279	2	2
β-strand	282	1	2
α-helix	289-297	9
β-strand	303-306	4	2
β-strand	308	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Presynaptic protein SAP97	A	protein	93	Rattus norvegicus	Q62696 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1ZOK_1 Presynaptic protein SAP97 (chains A)
EYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVN
EADVRDVTHSKAVEALKEAGSIVRLYVKRRKAF

Primary citation

Structural Characterization of the Intermolecular Interactions of Synapse-associated Protein-97 with the NR2B Subunit of N-Methyl-D-aspartate Receptors. Wang, L., Piserchio, A., Mierke, D.F. J Biol Chem (2005) 280:26992-26996. DOI 10.1074/jbc.M503555200 · PubMed

Other PDB entries of the same protein (UniProt Q62696 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2AWX 1.8 Å, Synapse associated protein 97 PDZ2 domain variant C378S
2AWW 2.21 Å, Synapse associated protein 97 PDZ2 domain variant C378G with C-terminal GluR-A peptide
2I0L 2.31 Å, X-ray crystal structure of Sap97 PDZ2 bound to the C-terminal peptide of HPV18 E6.
2G2L 2.35 Å, Crystal Structure of the Second PDZ Domain of SAP97 in Complex with a GluR-A C-terminal…
2AWU 2.44 Å, Synapse associated protein 97 PDZ2 domain variant C378G
3UAT 2.7 Å, Guanylate Kinase Domains of the MAGUK Family Scaffold Proteins as Specific…
2I0I 2.8 Å, X-ray crystal structure of Sap97 PDZ3 bound to the C-terminal peptide of HPV18 E6
1RSO Hetero-tetrameric L27 (Lin-2, Lin-7) domain complexes as organization platforms of…

Browse structure collections

About this viewer

MolViewer shows 1ZOK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.