2AWX: Synapse associated protein 97

Synapse associated protein 97 PDZ2 domain variant C378S. Determined by X-ray diffraction at 1.8 Å resolution. Released 29 Aug 2006.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 1,564
Mol. weight: 23.22 kDa
Ligands: HIS
Released: 29 Aug 2006

Explore 2AWX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2AWX contains 5 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	317-323	7	1
β-strand	325	1	2
β-strand	328	1	2
β-strand	331-335	5	1
β-strand	337	1	3
β-strand	342	1	4
β-strand	345	1	4
β-strand	348-353	6	1
α-helix	358-362	5
α-helix	369	1
β-strand	370-374	5	1
β-strand	377-378	2	1
β-strand	383	1	3
α-helix	384-392	9
β-strand	397-403	7	1

Chain B: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	318-323	6	5
β-strand	325	1	6
β-strand	328	1	6
β-strand	331-335	5	5
β-strand	337	1	7
β-strand	342	1	8
β-strand	345	1	8
β-strand	348-353	6	5
α-helix	358-362	5
β-strand	370-374	5	5
β-strand	377-378	2	5
β-strand	383	1	7
α-helix	384-392	9
β-strand	397-403	7	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Synapse associated protein 97	A, B	protein	105	Rattus norvegicus	Q62696 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2AWX_1 Synapse associated protein 97 (chains A, B)
MEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLA
VNSVSLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYISRHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
HIS	Histidine	C6 H10 N3 O2	2

Primary citation

Crystal structure of the second PDZ domain of SAP97 in complex with a GluR-A C-terminal peptide. von Ossowski, I., Oksanen, E., von Ossowski, L. et al. FEBS J (2006) 273:5219-5229. DOI 10.1111/j.1742-4658.2006.05521.x · PubMed

Other PDB entries of the same protein (UniProt Q62696 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2AWW 2.21 Å, Synapse associated protein 97 PDZ2 domain variant C378G with C-terminal GluR-A peptide
2I0L 2.31 Å, X-ray crystal structure of Sap97 PDZ2 bound to the C-terminal peptide of HPV18 E6.
2G2L 2.35 Å, Crystal Structure of the Second PDZ Domain of SAP97 in Complex with a GluR-A C-terminal…
2AWU 2.44 Å, Synapse associated protein 97 PDZ2 domain variant C378G
3UAT 2.7 Å, Guanylate Kinase Domains of the MAGUK Family Scaffold Proteins as Specific…
2I0I 2.8 Å, X-ray crystal structure of Sap97 PDZ3 bound to the C-terminal peptide of HPV18 E6
1RSO Hetero-tetrameric L27 (Lin-2, Lin-7) domain complexes as organization platforms of…
1ZOK PDZ1 Domain Of Synapse Associated Protein 97

Browse structure collections

About this viewer

MolViewer shows 2AWX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.