1ZR5: H2AFY protein

Crystal structure of the macro-domain of human core histone variant macroH2A1.2. Determined by X-ray diffraction at 2.92 Å resolution. Released 21 Jun 2005.

Method: X-ray diffraction
Resolution: 2.92 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,855
Mol. weight: 45.41 kDa
Released: 21 Jun 2005

Explore 1ZR5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ZR5 contains 13 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	182-188	7	1
β-strand	194-199	6	1
α-helix	202-207	6
β-strand	212-216	5	1
α-helix	226-250	25
β-strand	258-262	5	1
β-strand	270-274	5	1
α-helix	276-278	3
α-helix	284-301	18
β-strand	306-309	4	1
α-helix	321-338	18
β-strand	346-351	6	1
α-helix	354-365	12

Chain B: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	182-188	7	2
β-strand	194-199	6	2
α-helix	202-207	6
β-strand	212-217	6	2
α-helix	226-233	8
α-helix	236-250	15
β-strand	258-262	5	2
β-strand	270-275	6	2
α-helix	276-278	3
α-helix	284-301	18
β-strand	306-309	4	2
α-helix	321-338	18
β-strand	346-351	6	2
α-helix	354-365	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
H2AFY protein	A, B	protein	214	Homo sapiens	O75367 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1ZR5_1 H2AFY protein (chains A, B)
GAKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINP
TNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNS
PVWGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYF
VSTMSSSIKTVYFVLFDSESIGIYVQEMAKLDAN

Primary citation

Splicing regulates NAD metabolite binding to histone macroH2A. Kustatscher, G., Hothorn, M., Pugieux, C. et al. Nat Struct Mol Biol (2005) 12:624-625. DOI 10.1038/nsmb956 · PubMed

Other PDB entries of the same protein (UniProt O75367 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3HSV 1.43 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
1ZR3 1.66 Å, Crystal structure of the macro-domain of human core histone variant macroH2A1.1 (form B)
3IVB 1.75 Å, Structures of SPOP-Substrate Complexes: Insights into Architectures of BTB-Cul3…
3IID 1.9 Å, Crystal structure of the macro domain of human histone macroH2A1.1 in complex with…
3IIF 2.1 Å, Crystal structure of the macro domain of human histone macroH2A1.1 in complex with…
5IIT 2.13 Å, Structure of SPX domain of the yeast inorganic polyphophate polymerase Vtc4 crystallized…
3HQH 2.3 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
2FXK 2.54 Å, Crystal structure of the macro-domain of human core histone variant macroH2A1.1 (form A)
2F8N 2.9 Å, 2.9 Angstrom X-ray structure of hybrid macroH2A nucleosomes
9PM0 2.9 Å, nucleosome containing histone variant macroH2A
1U35 3.0 Å, Crystal structure of the nucleosome core particle containing the histone domain of…
7D3Y 3.11 Å, Crystal structure of the osPHR2-osSPX2 complex

Browse structure collections

About this viewer

MolViewer shows 1ZR5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.