1ZVD: Smad ubiquitination regulatory factor 2

Name: PDB 1ZVD: Regulation of Smurf2 Ubiquitin Ligase Activity by Anchoring the E2 to the HECT domain
Published: 2005-08-09
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Regulation of Smurf2 Ubiquitin Ligase Activity by Anchoring the E2 to the HECT domain. Determined by X-ray diffraction at 2.1 Å resolution. Released 9 Aug 2005.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,313
Mol. weight: 44.95 kDa
Ligands: PO4
Released: 9 Aug 2005

Explore 1ZVD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ZVD contains 23 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	372-386	15
β-strand	392-397	6	1
α-helix	402-411	10
α-helix	415-419	5
β-strand	421-426	6	1
α-helix	434-449	16
α-helix	452-454	3
β-strand	457-460	4	2
β-strand	463-469	7	2
α-helix	473-475	3
α-helix	479-495	17
α-helix	498-500	3
α-helix	506-512	7
α-helix	515-517	3
α-helix	522-525	4
α-helix	527-538	12
β-strand	550-555	6	3
β-strand	558-563	6	3
α-helix	578-590	13
α-helix	595-608	14
α-helix	611-614	4
α-helix	619-627	9
β-strand	629	1	4
α-helix	634-639	6
β-strand	641-644	4	5
α-helix	651-662	12
α-helix	665-676	12
β-strand	681	1	4
α-helix	686-688	3
β-strand	690-691	2	6
β-strand	694-695	2	6
β-strand	698-702	5	5
α-helix	710-711	2
β-strand	712-714	3	5
α-helix	715-717	3
β-strand	719-722	4	5
α-helix	728-739	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Smad ubiquitination regulatory factor 2	A	protein	380	Homo sapiens	Q9HAU4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1ZVD_1 Smad ubiquitination regulatory factor 2 (chains A)
KRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWKRLMIKFRG
EEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGR
IMGMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILENDITGVLDHT
FCVEHNAYGEIIQHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEV
IPQHLLKTFDEKELELIICGLGKIDVNDWKVNTRLKHCTPDSNIVKWFWKAVEFFDEERR
ARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLPKAHTCFNRIDIPPYESY
EKLYEKLLTAIEETCGFAVE

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1

Water and common crystallization additives (NA) are not listed.

Primary citation

Regulation of Smurf2 Ubiquitin Ligase Activity by Anchoring the E2 to the HECT Domain. Ogunjimi, A.A., Briant, D.J., Pece-Barbara, N. et al. Mol Cell (2005) 19:297-308. DOI 10.1016/j.molcel.2005.06.028 · PubMed

Other PDB entries of the same protein (UniProt Q9HAU4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9FSH 2.08 Å, Crystal structure of the HECT domain of Smurf 2 in complex with inhibitor 8
6FX4 2.5 Å, Disulfide between E3 HECT ligase Smurf2 and Ubiquitin G76C
7M3Q 2.5 Å, Structure of the Smurf2 HECT Domain with a High Affinity Ubiquitin Variant (UbV)
2DJY Solution structure of Smurf2 WW3 domain-Smad7 PY peptide complex
2JQZ Solution Structure of the C2 domain of human Smurf2
2KXQ Solution Structure of Smurf2 WW2 and WW3 bound to Smad7 PY motif containing peptide
2LTZ Smurf2 WW3 domain in complex with a Smad7 derived peptide

Browse structure collections

About this viewer

MolViewer shows 1ZVD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.