2JQZ: C2 domain of human Smurf2

Name: PDB 2JQZ: Solution Structure of the C2 domain of human Smurf2
Published: 2007-09-11
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Solution Structure of the C2 domain of human Smurf2. Determined by solution NMR. Released 11 Sept 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,033
Mol. weight: 14.7 kDa
Released: 11 Sept 2007

Explore 2JQZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JQZ contains 2 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	12-22	11	1
β-strand	35-41	7	2
β-strand	48-50	3	2
β-strand	60-69	10	1
β-strand	75-81	7	2
α-helix	82-87	6
β-strand	88	1	3
β-strand	91	1	3
β-strand	93-99	7	2
α-helix	101-110	10
β-strand	113-115	3	1
β-strand	131-138	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase SMURF2	A	protein	131	Homo sapiens	Q9HAU4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JQZ_1 E3 ubiquitin-protein ligase SMURF2 (chains A)
GPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPKWNQHYDLYI
GKSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKLGPNDNDTVR
GQIVVSLQSRD

Primary citation

Autoinhibition of the HECT-Type Ubiquitin Ligase Smurf2 through Its C2 Domain. Wiesner, S., Ogunjimi, A.A., Wang, H.-R. et al. Cell (2007) 130:651-662. DOI 10.1016/j.cell.2007.06.050 · PubMed

Other PDB entries of the same protein (UniProt Q9HAU4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9FSH 2.08 Å, Crystal structure of the HECT domain of Smurf 2 in complex with inhibitor 8
1ZVD 2.1 Å, Regulation of Smurf2 Ubiquitin Ligase Activity by Anchoring the E2 to the HECT domain
6FX4 2.5 Å, Disulfide between E3 HECT ligase Smurf2 and Ubiquitin G76C
7M3Q 2.5 Å, Structure of the Smurf2 HECT Domain with a High Affinity Ubiquitin Variant (UbV)
2DJY Solution structure of Smurf2 WW3 domain-Smad7 PY peptide complex
2KXQ Solution Structure of Smurf2 WW2 and WW3 bound to Smad7 PY motif containing peptide
2LTZ Smurf2 WW3 domain in complex with a Smad7 derived peptide

Browse structure collections

About this viewer

MolViewer shows 2JQZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.